ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LILRB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LILRB2 |
Rabbit Polyclonal Nephrin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
Rabbit Polyclonal RHBDD2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHBDD2 antibody was raised against an 18 amino acid peptide from near the center of human RHBDD2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CHRNA4 |
Rabbit anti-LAMP1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LAMP1 |
Rabbit polyclonal anti-ELOVL5 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ELOVL5. |
Rabbit polyclonal HLA-G Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal IFN-beta Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-HMOX1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HMOX1 |
Rabbit polyclonal antibody to Bcl-B (BCL2-like 10 (apoptosis facilitator))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 60 and 153 of BCL2L10 (Uniprot ID#Q9HD36) |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
CD133 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human CD133 |
Rabbit polyclonal antibody to GPR120 (G protein-coupled receptor 120)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 71 of GPR120 (Uniprot ID#Q5NUL3) |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal ROR2 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit Polyclonal TLR2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TLR2 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human TLR2. |
Rabbit Polyclonal TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TRPC6 antibody was raised against a 14 amino acid peptide from near the amino terminus of human TRPC6. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal anti-B3GALTL antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B3GALTL. |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit polyclonal ERBB2 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein. |
CD274 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD274 |
Rabbit anti-LTBR Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-GABRA5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal Anti-ACSL3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
Modifications | Phospho-specific |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit polyclonal His6-DEP-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Poly-HIS protein were used to produced this antibody. |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit polyclonal IL1R Antibody (C-term E487)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal SDF4 Antibody
Applications | ELISA, IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal LFG Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LFG antibody was raised against a 16 amino acid peptide from near the amino terminus of human LFG . |
Rabbit Polyclonal TIM-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | TIM-1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human TIM-1. |
Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit polyclonal FOLR1 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit anti-GP9 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GP9 |
Rabbit anti-SIGMAR1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIGMAR1 |
Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal CD30 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |