Antibodies

View as table Download

XRCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC4

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A

Rabbit anti-XRCC5 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human XRCC5

Rabbit polyclonal anti-DNA-PK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human DNA-PK.

Rabbit Polyclonal TdT Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.

Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010)

Rabbit polyclonal anti-XRCC6 / Ku70 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70.

Rabbit Polyclonal Ku80 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal antibody to XRCC4 (X-ray repair complementing defective repair in Chinese hamster cells 4)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 216 and 309 of XRCC4 (Uniprot ID#Q13426)

Rabbit polyclonal anti-XRCC6 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC6.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal XRCC6 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-548 amino acids from the C-terminal region of human XRCC6.

Rabbit polyclonal XRCC6 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This XRCC6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-254 amino acids from the Central region of human XRCC6.

Rabbit polyclonal XRCC5 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human XRCC5.

Rabbit Polyclonal Antibody against Mre11

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein

Rabbit polyclonal anti-XRCC6 / Ku70/80 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Ku70/80.
Modifications Phospho-specific

Goat polyclonal anti-Artemis antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C).

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit Polyclonal Anti-LIG4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LIG4 antibody: synthetic peptide directed towards the N terminal of human LIG4. Synthetic peptide located within the following region: DGERMQMHKDGDVYKYFSRNGYNYTDQFGASPTEGSLTPFIHNAFKADIQ

Goat Anti-POLL / BETA-N Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1.

Anti-XRCC6 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human X-ray repair complementing defective repair in Chinese hamster cells 6

Anti-XRCC6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human X-ray repair complementing defective repair in Chinese hamster cells 6

Anti-RAD50 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MRE11A

Rabbit Polyclonal Anti-MRE11A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MRE11A

G22P1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human G22P1

XRCC5 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5