TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit polyclonal HLA-G Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit Polyclonal Anti-IFNG Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IFNG |
Rabbit Polyclonal Anti-IL1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL1A |
Rabbit anti-HLA-A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-A |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit anti-GZMB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GZMB |
Rabbit Polyclonal Anti-Insulin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin |
Rabbit Polyclonal Anti-IL-12A Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
Rabbit anti-HLA-DPB1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-DPB1 |
IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta |
Rabbit polyclonal anti-GAD67/GAD1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GAD67. |
Modifications | Phospho-specific |
PRF1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRF1 |
Rabbit anti-HSPD1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSPD1 |
Rabbit polyclonal Granzyme B antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Granzyme B. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products. After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column. |
Rabbit polyclonal anti-HSP60 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human HSP60. |
GAD67 (GAD1) (526-537) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide from an internal region of human GAD1 / GAD67 (NP_000808.2) |
GAD65 (GAD2) (515-528) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse |
Immunogen | Synthetic peptide from an internal region of human GAD2 |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Hsp60 (HSPD1) rabbit polyclonal antibody
Applications | FC, IF, IHC, WB |
Reactivities | Mouse, Primate, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-FAS antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Fas. |
Rabbit polyclonal FAS ligand antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FAS ligand. |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Fas Ligand Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
LTA (Center) rabbit polyclonal antibody
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 46-72 amino acids from the Central region of Human LTA. |
Interferon gamma (IFNG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 31-80 of Human IFN-γ. |
IL12A rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
HLA-DOA rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide mapping at the middle region of human HSP60 |
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
IL12B (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 271-298aa) of human Interleukin-12 beta/IL12B. |
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Feline, Human, Mouse, Rat |
Immunogen | Synthetic peptide sequence from the C-terminus of GAD |
Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068) |
Rabbit polyclonal GAD2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 109-138 amino acids from the Central region of human GAD2. |
Rabbit polyclonal HSPD1 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal HLA-B Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Anti-Human IL-2 Goat Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Anti-Human IL-2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Anti-Human IFN-? Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IFN-γ |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit anti-IFNG Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFNG |
Rabbit Polyclonal HSP60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |