Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Rabbit Polyclonal antibody to NDUFS8 (NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 210 of NDUFS8 (Uniprot ID#O00217) |
Rabbit Polyclonal antibody to NDUFS2 (NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 430 of NDUFS2 (Uniprot ID#O75306) |
Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854) |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal antibody to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 432 and 664 of NDUFS1 (Uniprot ID#P28331) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 43 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFS4 (NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 175 of NDUFS4 (Uniprot ID#O43181) |
Rabbit polyclonal anti-ATP5G2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G2. |
Rabbit polyclonal anti-NDUFA3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA3. |
Rabbit polyclonal anti-NDUFB1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB1. |
Rabbit polyclonal anti-NDUFS5 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS5. |
Rabbit polyclonal ATP5J Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATP5J antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-56 amino acids from the Central region of human ATP5J. |
Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404) |
Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821) |
Rabbit Polyclonal antibody to NDUFA5 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 116 of NDUFA5 (Uniprot ID#Q16718) |
Rabbit Polyclonal antibody to ATP synthase delta (ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 168 of ATP synthase delta (Uniprot ID#P30049) |
Rabbit Polyclonal antibody to NDUFB9 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 162 of NDUFB9 |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit Polyclonal Anti-COX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Rabbit polyclonal anti-COX5B antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX5B. |
Rabbit polyclonal anti-NDUC2 antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUC2. |
Rabbit polyclonal anti-NDUFS6 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS6. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Oxidative phosphorylation
Filter by
Target Symbol
- ATP5F1B (24)
- NDUFB10 (15)
- SDHB (14)
- NDUFB9 (11)
- ATP6V1C2 (9)
- NDUFS2 (8)
- ATP6V1B1 (7)
- COX17 (7)
- ATP5ME (6)
- ATP6V1F (6)
- COX4I1 (6)
- COX6C (6)
- NDUFA4L2 (6)
- ATP5F1C (4)
- NDUFA2 (4)
- NDUFA7 (4)
- UQCRC1 (4)
- ATP5PF (3)
- ATP5PO (3)
- ATP6V0D2 (3)
- ATP6V1B2 (3)
- COX6B1 (3)
- NDUFA10 (3)
- NDUFS1 (3)
- PPA2 (3)
- UQCRFS1 (3)
- ATP5F1D (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- NDUFA5 (2)
- NDUFA8 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFS4 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFS8 (2)
- SDHA (2)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP6V0A2 (1)
- ATP6V1H (1)
- COX10 (1)
- COX11 (1)
- COX15 (1)
- COX5A (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX8A (1)
- LCMT2 (1)
- NDUFA1 (1)
- NDUFA3 (1)
- NDUFA4 (1)
- NDUFB1 (1)
- NDUFB5 (1)
- NDUFC2 (1)
- NDUFS3 (1)
- NDUFS7 (1)
- NDUFV1 (1)
- NDUFV2 (1)
- NDUFV3 (1)
- PPA1 (1)
- SDHD (1)
- UQCR10 (1)
- UQCRC2 (1)