Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Shc (Ab-349) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N). |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal p130 Cas (Tyr410) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human: Tyr410, Mouse: Tyr414, Rat: Tyr508 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p130 Cas around the phosphorylation site of tyrosine 410 (G-V-YP-A-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Rat
Applications
- IHC
Isotypes
- IgG
Families
- Druggable Genome
Pathways
- Regulation of actin cytoskeleton
Filter by
Category
Target Symbol
- PAK1 (8)
- FGFR3 (5)
- PXN (5)
- RAF1 (5)
- APC (4)
- BCAR1 (4)
- BRAF (4)
- CFL1 (4)
- MAPK1 (4)
- PAK2 (4)
- PPP1CB (4)
- ROCK2 (4)
- FGFR2 (3)
- LIMK2 (3)
- PAK5 (3)
- SHC1 (3)
- ACTN1 (2)
- BAIAP2 (2)
- BDKRB2 (2)
- CHRM1 (2)
- EGF (2)
- EGFR (2)
- EZR (2)
- F2R (2)
- FGF1 (2)
- FGF7 (2)
- FGFR1 (2)
- FN1 (2)
- GSN (2)
- ITGA7 (2)
- ITGAL (2)
- ITGAM (2)
- ITGAX (2)
- ITGB1 (2)
- ITGB4 (2)
- LIMK1 (2)
- MAP2K1 (2)
- MAP2K2 (2)
- MAPK3 (2)
- MSN (2)
- PAK3 (2)
- PDGFA (2)
- PDGFB (2)
- PIK3R1 (2)
- PIKFYVE (2)
- PPP1CC (2)
- PTK2 (2)
- ROCK1 (2)
- SLC9A1 (2)
- VCL (2)
- WASF2 (2)
- ACTN4 (1)
- ARAF (1)
- ARHGEF6 (1)
- CDC42 (1)
- CFL2 (1)
- CHRM2 (1)
- CHRM3 (1)
- CHRM5 (1)
- CRK (1)
- CRKL (1)
- DOCK1 (1)
- F2 (1)
- FGF2 (1)
- FGF3 (1)
- FGF4 (1)
- GNA13 (1)
- HRAS (1)
- INS (1)
- ITGAV (1)
- ITGB2 (1)
- ITGB3 (1)
- ITGB6 (1)
- MYLK3 (1)
- NCKAP1 (1)
- NRAS (1)
- PAK4 (1)
- PDGFC (1)
- PDGFRA (1)
- PDGFRB (1)
- PFN2 (1)
- PIK3CA (1)
- PIK3CB (1)
- PIK3R2 (1)
- PIK3R3 (1)
- PIP4K2A (1)
- PIP5K1B (1)
- PIP5K1C (1)
- PPP1CA (1)
- PPP1R12A (1)
- RAC1 (1)
- RAC2 (1)
- RDX (1)
- RRAS (1)
- RRAS2 (1)
- SSH3 (1)
- VAV1 (1)
- VAV2 (1)
- WASL (1)