c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | FITC |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC
Applications | FC, IF, IHC |
Reactivities | Human |
Conjugation | FITC |
Goat Polyclonal Antibody against FOXA2
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal Smad3 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Anti-CD9 Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Rabbit polyclonal FOXA2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit polyclonal KLF4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This KLF4 antibody is generated from rabbits immunized with a his tag recombinant protein of human KLF4. |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Anti-Human GDF-3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human GDF-3 |
Anti-Human KGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human KGF (FGF-7) |
Rabbit Polyclonal anti-GATA6 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-PAX3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
Rabbit anti-SOX2 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOX2 |
Rabbit Polyclonal PDX-1/IPF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945] |
Rabbit Polyclonal GLI-2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli2 protein (between residues 300-400) [UniProt P10070] |
Rabbit Polyclonal KLF4 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 1-50 of human KLF4 was used as the immunogen for this antibody. |
CD34 mouse monoclonal antibody, clone n.a, FITC
Applications | FC, IHC |
Reactivities | Human |
Conjugation | FITC |
CD34 Class III mouse monoclonal antibody, clone B-F23, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD34 Class III mouse monoclonal antibody, clone B-F23, Purified
Applications | FC, IHC |
Reactivities | Human |
SMAD3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
SMAD2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
FGF4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of the human FGF4 |
SMAD2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the N-terminal of human SMAD2/3 |
EGF (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF |
KGF (FGF7) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 64-94 amino acids from the Central region of human FGF7 |
GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5 |
GDF 9 (GDF9) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 87-117 amino acids from the N-terminal region of Human GDF9 |
PROX1 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Immunogen | Peptide corresponding to the Homeobox domain of Prox1. |
BDNF goat polyclonal antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against MYC (T58)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC. |
Rabbit Polyclonal Antibody against CDX2 (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human CDX2. |
Goat Polyclonal Antibody against PAX3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1. |
Rabbit Polyclonal POU5F1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | POU5F1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human POU5F1. |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GLI-3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3. |
Anti-NODAL Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig |
Immunogen | NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%). |
Rabbit polyclonal anti-SMAD3 antibody
Applications | IHC, WB |
Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Anti-SMAD2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2. |
Anti-KIT (phospho-Tyr936) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 936 (H-I-Y(p)-S-N) derived from Human c-Kit. |
Modifications | Phospho-specific |
Anti-SMAD3 Rabbit Polyclonal Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3. |
Rabbit polyclonal FGF4 Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Rabbit Polyclonal anti-UTF1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UTF1 antibody: synthetic peptide directed towards the middle region of human UTF1. Synthetic peptide located within the following region: AREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL |
Rabbit Polyclonal Anti-BMP7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit Polyclonal Anti-PAX7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit Polyclonal Smad2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
Conjugation | Unconjugated |
Immunogen | Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen. |
Rabbit Polyclonal SOX2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Chicken, Feline, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 100-150 of human SOX2 was used as the immunogen for the antibody. |
Rabbit anti CD9 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein encoding the full length of human CD9. |
Rabbit anti SOX-2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
CD44 mouse monoclonal antibody, clone 156-3C11, Purified
Applications | IHC |
Reactivities | Human |