Germany
Japan
United Kingdom
China
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC
| Applications | FC, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Antibodies
View as table Download
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal Smad3 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal anti-GATA6 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-PAX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX3 antibody: synthetic peptide directed towards the C terminal of human PAX3. Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
CD34 Class III mouse monoclonal antibody, clone B-F23, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD34 Class III mouse monoclonal antibody, clone B-F23, Purified
| Applications | FC, IHC |
| Reactivities | Human |
PROX1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Immunogen | Peptide corresponding to the Homeobox domain of Prox1. |
Rabbit Polyclonal Antibody against CDX2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human CDX2. |
Goat Polyclonal Antibody against PAX3
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TTLAGAVPRMM-C, from the N Terminus of the protein sequence according to NP_000429.2; NP_039230.1; NP_852122;.1 NP_852123.1; NP_852124.1; NP_852125.1; NP_852126.1. |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
| Modifications | Phospho-specific |
Anti-NODAL Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Monkey, Pig |
| Immunogen | NODAL antibody was raised against synthetic peptide (DRSQLCRKVKFQ) from internal region of human NODAL. Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Panda, Bovine, Dog, Bat, Horse, Pig (100%); Mouse, Rat, Hamster (92%); Elephant (83%). |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal FGF4 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-198 amino acids from the C-terminal region of human FGF4. |
Rabbit Polyclonal anti-UTF1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UTF1 antibody: synthetic peptide directed towards the middle region of human UTF1. Synthetic peptide located within the following region: AREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL |
Rabbit Polyclonal Anti-BMP7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit anti SOX-2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
CD44 mouse monoclonal antibody, clone 156-3C11, Purified
| Applications | IHC |
| Reactivities | Human |
Active filters
Applications
- IHC
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- KIT (58)
- CD44 (47)
- GLI1 (40)
- CD34 (34)
- MYC (32)
- CD14 (30)
- CDX2 (20)
- FGF21 (19)
- EGF (16)
- SOX9 (15)
- PDX1 (13)
- KLF5 (12)
- SMAD3 (12)
- GLI2 (11)
- OTX2 (11)
- FOXA2 (10)
- POU5F1 (10)
- BDNF (9)
- SOX2 (9)
- GATA4 (7)
- GATA6 (7)
- IGFBP1 (7)
- BMP4 (6)
- GRB7 (6)
- SMAD2 (6)
- KLF4 (5)
- NANOG (5)
- PROX1 (5)
- FGF4 (4)
- FGF7 (4)
- PAX3 (4)
- PAX7 (4)
- BMP15 (3)
- BMP2 (3)
- BMP7 (3)
- CD9 (3)
- GDF9 (3)
- GLI3 (3)
- HNF1B (3)
- BMP5 (2)
- BMP6 (2)
- DNMT3B (2)
- DPPA2 (2)
- GDF3 (2)
- NEUROD1 (2)
- TAT (2)
- BMP8B (1)
- CCN4 (1)
- FGF10 (1)
- GDF5 (1)
- HBZ (1)
- IGFBP2 (1)
- NODAL (1)
- PAX6 (1)
- PDGFC (1)
- TDGF1 (1)
- UTF1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (215)
- Hematopoietic cell lineage (175)
- MAPK signaling pathway (115)
- Acute myeloid leukemia (93)
- Cytokine-cytokine receptor interaction (82)
- Endocytosis (77)
- Regulation of actin cytoskeleton (75)
- Hedgehog signaling pathway (71)
- TGF-beta signaling pathway (69)
- Basal cell carcinoma (63)
- Melanogenesis (61)
- Cell cycle (50)
- Colorectal cancer (50)
- Wnt signaling pathway (50)
- Bladder cancer (48)
- Endometrial cancer (48)
- ErbB signaling pathway (48)
- ECM-receptor interaction (47)
- Melanoma (45)
- Chronic myeloid leukemia (44)
- Cell adhesion molecules (CAMs) (34)
- Pancreatic cancer (34)
- Jak-STAT signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Pathogenic Escherichia coli infection (30)
- Toll-like receptor signaling pathway (30)
- Maturity onset diabetes of the young (29)
- Adherens junction (18)
- Focal adhesion (17)
- Gap junction (17)
- Prostate cancer (17)
- Glioma (16)
- Non-small cell lung cancer (16)
- Type II diabetes mellitus (13)
- Huntington's disease (9)
- Neurotrophin signaling pathway (9)
- Cysteine and methionine metabolism (4)
- Metabolic pathways (4)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Tyrosine metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- tyrosine and tryptophan biosynthesis (2)