Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 524.00
In Stock
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
CDC25A Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC25A |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
| Modifications | Phospho-specific |
Rabbit polyclonal PTP4A2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Goat Polyclonal Antibody against DUSP16
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
| Modifications | Phospho-specific |
Anti-PTPN11 (Phospho-Tyr542) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 542 (H-E-Y(p)-T-N) derived from Human SHP-2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
| Modifications | Phospho-specific |
Rabbit polyclonal MKP1 (Ser359) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PPP1R1C antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R1C. |
PTPRM Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
Anti-DUSP4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 197-394 amino acids of human dual specificity phosphatase 4 |
Anti-PPP1CB Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 327 amino acids of human protein phosphatase 1, catalytic subunit, beta isozyme |
Anti-PTPN6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 244-515 amino acids of human protein tyrosine phosphatase, non-receptor type 6 |
Active filters
Reactivities
- Mouse
Applications
- IHC
Isotypes
- IgG
Families
- Phosphatase
Filter by
Category
Target Symbol
- PTEN (7)
- CDC25A (4)
- PPP1CB (4)
- DUSP1 (3)
- DUSP6 (3)
- PTP4A2 (3)
- PTPN11 (3)
- PTPRM (3)
- DUSP12 (2)
- DUSP16 (2)
- DUSP4 (2)
- DUSP8 (2)
- PPP1CC (2)
- PPP2CB (2)
- PTPRC (2)
- PTPRE (2)
- PTPRJ (2)
- PTPRK (2)
- SET (2)
- CDC25B (1)
- CDKN3 (1)
- CTDSP1 (1)
- DUSP10 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP22 (1)
- DUSP23 (1)
- DUSP26 (1)
- DUSP3 (1)
- DUSP7 (1)
- ILKAP (1)
- MTMR4 (1)
- MTMR7 (1)
- PDP1 (1)
- PPM1K (1)
- PPP1CA (1)
- PPP1R1C (1)
- PPP2CA (1)
- PPP2R1B (1)
- PPP2R2A (1)
- PPP2R3A (1)
- PPP3CA (1)
- PPP3CB (1)
- PPP4C (1)
- PTPN12 (1)
- PTPN20 (1)
- PTPN22 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
- PTPN6 (1)
- PTPN7 (1)
- SIRPA (1)
- SSH3 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- MAPK signaling pathway (22)
- Focal adhesion (14)
- Oocyte meiosis (13)
- Tight junction (12)
- Long-term potentiation (9)
- Regulation of actin cytoskeleton (8)
- Endometrial cancer (7)
- Glioma (7)
- Inositol phosphate metabolism (7)
- Insulin signaling pathway (7)
- Melanoma (7)
- Pathways in cancer (7)
- Phosphatidylinositol signaling system (7)
- Prostate cancer (7)
- Small cell lung cancer (7)
- Vascular smooth muscle contraction (7)
- p53 signaling pathway (7)
- Adherens junction (6)
- Natural killer cell mediated cytotoxicity (6)
- Wnt signaling pathway (6)
- Cell adhesion molecules (CAMs) (5)
- Cell cycle (5)
- Progesterone-mediated oocyte maturation (5)
- T cell receptor signaling pathway (5)
- Jak-STAT signaling pathway (4)
- Long-term depression (4)
- TGF-beta signaling pathway (4)
- Adipocytokine signaling pathway (3)
- B cell receptor signaling pathway (3)
- Chronic myeloid leukemia (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Leukocyte transendothelial migration (3)
- Neurotrophin signaling pathway (3)
- Renal cell carcinoma (3)
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Axon guidance (2)
- Calcium signaling pathway (2)
- Fc gamma R-mediated phagocytosis (2)
- Primary immunodeficiency (2)
- VEGF signaling pathway (2)
- Fructose and mannose metabolism (1)
- Metabolic pathways (1)
- Riboflavin metabolism (1)
- Thiamine metabolism (1)