Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of the human Nhe-1. The immunogen is located within the last 50 amino acids of Nhe-1. |
Rabbit Polyclonal Nhe-1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nhe-1 antibody was raised against a 17 amino acid synthetic peptide near the center of the human Nhe-1. The immunogen is located within amino acids 490 - 540 of Nhe-1. |
Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698) |
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit Polyclonal antibody to ATPase beta3 (Na+/K+) (ATPase, Na+/K+ transporting, beta 3 polypeptide)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 279 of ATPase beta3 (Na+/K+) (Uniprot ID#P54709) |
Rabbit Polyclonal Anti-ATP1B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 17 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Rabbit, Lizard (88%); Elephant, Panda, Bat, Bovine, Dog, Horse, Pig, Turkey, Chicken, Xenopus (82%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bovine, Horse, Rabbit (100%); Elephant, Bat, Pig, Guinea pig (94%); Galago, Platypus (83%). |
USD 465.00
4 Weeks
USD 465.00
In Stock
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 897-911 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Rabbit Polyclonal Anti-ATP1B2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATP1B2 |
Rabbit Polyclonal Anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CACNA1C |
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
COX6C mouse monoclonal antibody,clone OTI4A5
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
Active filters
Applications
- IHC
Families
- Transmembrane
Pathways
- Cardiac muscle contraction