Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal Fibronectin/Anastellin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made toward the C-terminal region of the human Fibronectin protein (within residues 2250-2300). [Swiss-Prot P02751] |
Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Collagen XI a2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen XI a2. |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal ITGB4 (Tyr1510) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%). |
Rabbit anti Osteopontin(SPP1) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal portion of Osteopontin protein sequence. This sequence is identical to human, rat and mouse origins. |
Rabbit anti-THBS1 polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal THBS1 antibody was raised against a peptide from near the N terminal residues of human THBS1 protein. |
Rabbit polyclonal anti-LAMA5 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA5. |
Rabbit polyclonal anti-TNXB antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNXB. |
Carrier-free (BSA/glycerol-free) FN1 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Mouse
Applications
- IHC
Pathways
- ECM-receptor interaction
Filter by
Category
Target Symbol
- FN1 (18)
- ITGB3 (12)
- LAMA4 (6)
- COL1A1 (5)
- LAMB2 (5)
- CD44 (4)
- COL4A1 (3)
- LAMA1 (3)
- SPP1 (3)
- THBS1 (3)
- TNC (3)
- TNXB (3)
- AGRN (2)
- COL2A1 (2)
- COL3A1 (2)
- ITGA7 (2)
- ITGB1 (2)
- ITGB4 (2)
- LAMA3 (2)
- LAMA5 (2)
- LAMB3 (2)
- TNN (2)
- TNR (2)
- VWF (2)
- CD47 (1)
- COL11A2 (1)
- COL1A2 (1)
- COL4A2 (1)
- COL6A2 (1)
- COL6A3 (1)
- COMP (1)
- GP1BA (1)
- GP6 (1)
- GP9 (1)
- HMMR (1)
- HSPG2 (1)
- IBSP (1)
- ITGA11 (1)
- ITGA2 (1)
- ITGA2B (1)
- ITGA3 (1)
- ITGA6 (1)
- ITGAV (1)
- ITGB5 (1)
- ITGB6 (1)
- LAMA2 (1)
- LAMB1 (1)
- LAMC3 (1)
- SDC1 (1)
- SDC4 (1)
- SV2A (1)
- THBS2 (1)
- VTN (1)