Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
USD 525.00
5 Days
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Human |
| Immunogen | Purified Collagen type I from Human skin. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IF, IHC |
| Reactivities | Fish |
| Immunogen | Collagen Type I extracted and purified from salmon fish skin. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Collagen Type I from Human and Bovine Placenta |
Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
USD 425.00
5 Days
Collagen I (COL1A1) (+ type II, III, IV, and V) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human |
| Immunogen | A mixture of human collagen 1-5 from human placenta. |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Fish, Goldfish |
| Immunogen | Purified collagen type I from goldfish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Salmon, Sole, Tuna |
| Immunogen | Purified Collagen type I from Salmon skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Bonito, Fish, Tuna |
| Immunogen | Purified Collagen type I from Tuna Fish skin |
Collagen I (COL1A1) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, R |
| Reactivities | Porcine |
| Immunogen | Purified Collagen type I from Porcine tendon. |
Collagen I (COL1A1) mouse monoclonal antibody, clone BDI314, Azide Free
| Applications | ELISA, IHC |
| Reactivities | Human |
Collagen I (COL1A1) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Human type 1 Collagen |
Active filters
Target Symbol
- COL1A1
Applications
- IHC
Pathways
- Focal adhesion