Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit anti-EZH2 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EZH2 |
Mouse Monoclonal BRG1 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti-EED Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human EED |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
USD 516.00
In Stock
Rabbit anti-BMI1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMI1 |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
Rabbit anti-TARDBP Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TARDBP |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit anti-TCEB2 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TCEB2 |
Rabbit anti-FLI1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FLI1 |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal HDAC9 Antibody (N-term)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2-32 amino acids from the N-terminal region of human HDAC9. |
Rabbit Polyclonal Anti-hKV11.1 (HERG)
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG). Intracellular, C-terminus. |
Rabbit Polyclonal anti-RBPSUH antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBPSUH antibody: synthetic peptide directed towards the C terminal of human RBPSUH. Synthetic peptide located within the following region: RPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Mouse Monoclonal PRMT4/CARM1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Mouse Monoclonal PRMT4/CARM1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IP
Conjugates
- Unconjugated
Families
- Transcription Factors
Filter by
Target Symbol
- NEUROG1 (27)
- SSB (3)
- HIF1A (2)
- HP1 GAMMA (2)
- MCM7 (2)
- PRMT4 (2)
- RCOR1 (2)
- BMI1 (1)
- CDX2 (1)
- EED (1)
- ELOB (1)
- ENO1 (1)
- ESRRA (1)
- EZH2 (1)
- FLI1 (1)
- HDAC1 (1)
- HDAC2 (1)
- HDAC9 (1)
- IRF3 (1)
- KCNH2 (1)
- LDB1 (1)
- LITAF (1)
- MCM3 (1)
- MCM5 (1)
- MCM6 (1)
- MNAT1 (1)
- NR4A3 (1)
- POLR2C (1)
- POLR2D (1)
- PRDM14 (1)
- RBPJ (1)
- RNF2 (1)
- RUVBL2 (1)
- SATB1 (1)
- SIN3A (1)
- SMARCA4 (1)
- SMARCB1 (1)
- SOX13 (1)
- TARDBP (1)
- TERF2 (1)
Antibody Hosts
Clonalities
Pathways
- Cell cycle (7)
- Huntington's disease (7)
- DNA replication (5)
- Pathways in cancer (5)
- Metabolic pathways (3)
- Notch signaling pathway (3)
- Renal cell carcinoma (3)
- Systemic lupus erythematosus (3)
- Chronic myeloid leukemia (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- RNA polymerase (2)
- mTOR signaling pathway (2)
- Cytosolic DNA-sensing pathway (1)
- Glycolysis / Gluconeogenesis (1)
- Nucleotide excision repair (1)
- RIG-I-like receptor signaling pathway (1)
- RNA degradation (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)