Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit monoclonal antibody against PIP5K1C(clone MAO-R1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal Filamin A (Ser2152) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Filamin A around the phosphorylation site of Serine 2152 |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal anti-Vinculin antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VCL |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
USD 524.00
In Stock
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Goat Polyclonal Antibody against Caveolin 1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
Rabbit Polyclonal XIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873) |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
| Modifications | Phospho-specific |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-PPP1CA Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPP1CA |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit anti-ROCK2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ROCK2 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal Anti-MYLK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYLK2 |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- WB
Conjugates
- Unconjugated
Pathways
- Focal adhesion
Filter by
Target Symbol
- MAP2K1 (133)
- JUN (111)
- ERBB2 (93)
- CTNNB1 (91)
- EGFR (88)
- AKT1 (83)
- BRAF (59)
- BCL2 (51)
- MAPK1 (43)
- MET (38)
- PARVA (36)
- PIK3CG (36)
- PDGFRA (34)
- MAPK8 (27)
- PIK3R5 (27)
- HRAS (26)
- KDR (26)
- PXN (26)
- VASP (26)
- ACTB (25)
- CCND2 (25)
- AKT2 (24)
- PDGFRB (21)
- RAPGEF1 (21)
- SHC1 (21)
- BCAR1 (20)
- PTK2 (20)
- IGF1R (19)
- MAPK9 (19)
- PARVB (18)
- CCND1 (17)
- PIK3CD (17)
- PRKCA (17)
- MYL7 (16)
- RAF1 (15)
- SRC (15)
- VEGFB (15)
- GSK3B (14)
- FLT4 (13)
- HGF (13)
- IGF1 (13)
- MAPK3 (13)
- PTEN (13)
- FN1 (12)
- MAPK10 (12)
- PAK1 (12)
- PAK4 (12)
- BAD (11)
- CAV1 (11)
- ITGB1 (11)
- ROCK2 (11)
- AKT3 (10)
- VCL (10)
- ITGB3 (9)
- ACTN1 (8)
- CAPN2 (8)
- FYN (8)
- PIK3R1 (8)
- PRKCB (8)
- SPP1 (8)
- ELK1 (7)
- ILK (7)
- LAMA4 (7)
- RHOA (7)
- VEGFA (7)
- CCND3 (6)
- GRB2 (6)
- PAK2 (6)
- PPP1CA (6)
- VAV1 (6)
- XIAP (6)
- ACTG1 (5)
- FLNA (5)
- ITGAV (5)
- ITGB4 (5)
- MYL9 (5)
- VEGFC (5)
- BIRC2 (4)
- CDC42 (4)
- COL2A1 (4)
- COL3A1 (4)
- ITGA4 (4)
- LAMB2 (4)
- PAK3 (4)
- PAK5 (4)
- PDGFB (4)
- PDGFC (4)
- PDPK1 (4)
- PPP1CB (4)
- PRKCG (4)
- RAC1 (4)
- RAP1A (4)
- ACTN2 (3)
- ACTN3 (3)
- ACTN4 (3)
- ARHGAP5 (3)
- COL1A1 (3)
- COL5A2 (3)
- COL6A1 (3)
- CRKL (3)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1809)
- Protein Kinase (927)
- ES Cell Differentiation/IPS (779)
- Transmembrane (455)
- Transcription Factors (217)
- Secreted Protein (182)
- Stem cell - Pluripotency (138)
- Stem cell relevant signaling - JAK/STAT signaling pathway (120)
- Adult stem cells (107)
- Cancer stem cells (88)
- Phosphatase (26)
- Protease (21)
- Stem cell relevant signaling - DSL/Notch pathway (17)
- Stem cell relevant signaling - Wnt Signaling pathway (17)
- Embryonic stem cells (6)
- Induced pluripotent stem cells (6)