Germany
Japan
United Kingdom
China
USD 399.00
In Stock
Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD19 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit anti-CD3E Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD3E |
Rabbit anti-ZAP70 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ZAP70 |
USD 240.00
2 Weeks
Rabbit anti-CD19 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CD19 |
Phospho-ZAP70-Y319 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y319 of human ZAP70 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-BTK(Tyr223) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-BTK(Tyr223) Antibody: A synthesized peptide derived from human BTK around the phosphorylation site of Tyrosine 223 |
| Modifications | Phospho-specific |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-85) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R) |
Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
Rabbit polyclonal anti-RFX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal LCK Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
| Modifications | Phospho-specific |
Rabbit anti-IL2RG Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL2RG |
Rabbit anti-RAG2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAG2 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-IGLL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Active filters
Filter by
Target Symbol
- CD4 (202)
- CD19 (65)
- PTPRC (65)
- BTK (61)
- CD40 (60)
- UNG (57)
- RFXANK (47)
- IKBKG (39)
- LCK (22)
- CD3E (20)
- BLNK (19)
- AIRE (15)
- ZAP70 (15)
- CD8A (14)
- JAK3 (14)
- CIITA (11)
- CD79A (8)
- ADA (6)
- CD40LG (5)
- DCLRE1C (5)
- CD8B (4)
- CD3D (3)
- IL2RG (3)
- IL7R (3)
- RAG2 (3)
- RFX5 (3)
- TNFRSF13B (3)
- TNFRSF13C (3)
- AICDA (2)
- TAP1 (2)
- TAP2 (2)
- ICOS (1)
- IGLL1 (1)
- RFXAP (1)