USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
USD 399.00
In Stock
CD19 mouse monoclonal antibody,clone 3B10, DyLight 488 conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | DyLight 488 |
CD19 mouse monoclonal antibody,clone 3B10, PE conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | PE |
Rabbit Polyclonal Antibody against CD19 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 143-172 amino acids from the N-terminal region of human CD19. |
Goat Polyclonal Anti-CD45 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit anti-IL7R Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL7R |
BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
Goat Polyclonal Anti-CD19 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
Rabbit Polyclonal CD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal AID Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | AID antibody was raised against a peptide corresponding to 14 amino acids near the carboxy-terminus of human AID. |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Goat Polyclonal Anti-CD4 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
AIRE Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human AIRE |
ICOS Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ICOS |
Phospho-ZAP70-Y493 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y493 of human ZAP70 |
Modifications | Phospho-specific |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against CD8A (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal antibody to RAG2 (recombination activating gene 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 271 and 527 of RAG2 (Uniprot ID#P55895) |
ADA Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADA |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit Monoclonal Antibody against BLNK (Clone Y491)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-CD3E Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD3E |
Rabbit anti-ZAP70 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ZAP70 |
USD 240.00
2 Weeks
CD3E (activation epitope) mouse monoclonal antibody, clone APA1/1, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
CD4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 391-440 of Human CD4. |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
IL2 Receptor gamma (IL2RG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 76 - 101 amino acids from the N-terminal region of Human CD132 / IL2RG |
Rabbit anti-CD19 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD19 |
Phospho-ZAP70-Y319 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y319 of human ZAP70 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-BTK(Tyr223) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-BTK(Tyr223) Antibody: A synthesized peptide derived from human BTK around the phosphorylation site of Tyrosine 223 |
Modifications | Phospho-specific |
JAK3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
BTK (91-387) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant Human Btk, protein fragment containing a sequence corresponding to a region with amino acids 91 and 387 of Human Btk |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R). |
Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-85) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R) |
Rabbit polyclonal anti-OR10G6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10G6. |
Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M). |
Modifications | Phospho-specific |
Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CIITA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
Rabbit polyclonal anti-RFX5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit polyclonal LCK Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Rabbit Polyclonal CD19 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
Modifications | Phospho-specific |
Rabbit anti-IL2RG Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL2RG |
Rabbit anti-RAG2 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RAG2 |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-IGLL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |