Rabbit polyclonal Eif3S6 Int6 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the C-terminus of mouse EIF3S6/Int6. |
Rabbit polyclonal anti-WHIP antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the WHIP1 protein. The immunogen sequence shows 100% homology to human WHIP1 (isoform 1) and WHIP2 (isoform 2) with predicted molecular weights of 72.2 kDa and 69.5 kDa, respectively. The immunogen sequence also shows 100% homology to WHIP1 from mouse, rat and monkey sequences. Reactivity with WHIP proteins from other sources is not known, but is likely due to reported homologies. |
Rabbit polyclonal TAF7 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAF7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-337 amino acids from the C-terminal region of human TAF7. |
Rabbit polyclonal TSPYL2 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TSPYL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-409 amino acids from the Central region of human TSPYL2. |
Rabbit polyclonal PPP2R2A Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPP2R2A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-71 amino acids from the N-terminal region of human PPP2R2A. |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL |
Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSC |
Rabbit Polyclonal Anti-RAB9A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB9A antibody: synthetic peptide directed towards the middle region of human RAB9A. Synthetic peptide located within the following region: SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFV |
Rabbit Polyclonal Anti-AKR1C1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKR1C1 antibody: synthetic peptide directed towards the N terminal of human AKR1C1. Synthetic peptide located within the following region: DSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPAL |
AKT2 Rabbit polyclonal Antibody
| Applications | ChIP, ICC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AKT2 |
| Modifications | Unmodified |
CTCF Rabbit polyclonal Antibody
| Applications | ChIP, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1). |
| Modifications | Unmodified |
Fibrillarin/U3 RNP Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 100-321 of human Fibrillarin/U3 RNP (NP_001427.2). |
| Modifications | Unmodified |
NBR1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NBR1 |
| Modifications | Unmodified |
PSMA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-261 of human PSMA4 (NP_001096137.1). |
| Modifications | Unmodified |
PSMD4 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-377 of human PSMD4 (NP_002801.1). |
| Modifications | Unmodified |
SH3GL1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1). |
| Modifications | Unmodified |
SLC12A3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC12A3. |
STIP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human STIP1 (NP_006810.1). |
| Modifications | Unmodified |
Phospho-AMPK alpha 1/2 (Thr183/Thr172) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human AMPK alpha around the phosphorylation site of Thr172. AA range:140-189 (Phosphorylated) |
FSP1 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the Internal region of human AMID. at AA rangle: 110-190 |
Annexin V Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Annexin V protein fragments expressed in E.coli. |
Annexin V Rabbit polyclonal Antibody (HRP)
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | HRP |
| Immunogen | Purified recombinant human Annexin V protein fragments expressed in E.coli. |
Cyclin A1 Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin A. AA range:221-270 |
eIF2A Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human eIF2 alpha. AA range:21-70 |
GRP78 BiP Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human GRP78. AA range:605-654 |
Phospho-IGF1 Receptor (Tyr1165/Tyr1166) Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human IGF1R around the phosphorylation site of Tyr1165/Tyr1166. AA range:1131-1180 (Phosphorylated) |
Phospho-IKK beta (Tyr188) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human IKK-beta around the phosphorylation site of Tyr188. AA range:161-210 (Phosphorylated) |
Myomesin 2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MYOM2. AA range:612-661 |
Phospho-IKB alpha (Ser32/Ser36) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human IkappaB-alpha around the phosphorylation site of Ser32/Ser36. AA range:15-64 (Phosphorylated) |
Phospho-PI3 Kinase p85/p55 (Tyr467/Tyr199) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PI3-kinase p85-alpha/gamma around the phosphorylation site of Tyr467/199. AA range:436-485 (Phosphorylated) |
PKM2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CVTEVENGGSLGSKKGVNLP |
Phospho-NF kappa B p65 (Ser536) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NF-kappaB p65 around the phosphorylation site of Ser536. AA range:502-551 (Phosphorylated) |
Phospho-Sp1 (Thr739) Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from human Sp1 around the phosphorylation site of T739. (Phosphorylated) |
Phospho-STAT1 (Tyr701) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human STAT1 around the phosphorylation site of Tyr701. AA range:668-717 (Phosphorylated) |
Phospho-STAT3 (Ser727) Rabbit polyclonal Antibody
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human STAT3 around the phosphorylation site of Ser727. AA range:694-743 (Phosphorylated) |
Germany
Japan
United Kingdom
China
