BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
Phospho-ZAP70-Y493 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y493 of human ZAP70 |
Modifications | Phospho-specific |
Rabbit anti-ZAP70 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ZAP70 |
Phospho-ZAP70-Y319 Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y319 of human ZAP70 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-BTK(Tyr223) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-BTK(Tyr223) Antibody: A synthesized peptide derived from human BTK around the phosphorylation site of Tyrosine 223 |
Modifications | Phospho-specific |
Rabbit polyclonal LCK Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Rabbit polyclonal BTK (Tyr223) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 223 (A-L-YP-D-Y). |
Modifications | Phospho-specific |
Rabbit polyclonal ZAP70 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70. |
Rabbit polyclonal LCK Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK. |
Rabbit Polyclonal Lck Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck |
Rabbit Polyclonal Lck Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck |
Rabbit Polyclonal Lck (Tyr393) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 393 |
Modifications | Phospho-specific |
Mouse Monoclonal BTK Antibody (7F12H4)
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal BTK Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | BTK antibody was raised against a synthetic peptide corresponding to 16 amino acids near the amino-terminus of human BTK. |
Rabbit Polyclonal BTK [p Tyr223] Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide made to a peptide surrounding amino acid 223 of the human BTK protein (between residues 200-250) [UniProt Q06187] |
Rabbit anti-ZAP70 (Phospho-Tyr319) polyclonal antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanZap-70 around the phosphorylation site of tyrosine 319 (S-P-YP-S-D). |
Modifications | Phospho-specific |
Rabbit polyclonal LCK (Ser59) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human LCK around the phosphorylation site of serine 59 (P-A-SP-P-L). |
Modifications | Phospho-specific |
Rabbit polyclonal Lck (Tyr393) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Lck around the phosphorylation site of tyrosine 393 (N-E-YP-T-A). |
Modifications | Phospho-specific |
Rabbit polyclonal Zap-70 (Tyr319) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Zap-70 around the phosphorylation site of tyrosine 319 (S-P-YP-S-D). |
Modifications | Phospho-specific |
Rabbit polyclonal BTK (Ab-222) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 222 (A-L-YP-D-Y). |
Anti-LCK (Phospho-Tyr394) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 394 (N-E-Y(p)-T-A) derived from Human Lck. |
Modifications | Phospho-specific |
Anti-LCK Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.392-396(N-E-Y-T-A) derived from Human Lck. |
Anti-ZAP70 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.317~321 (S-P-Y-S-D) derived from Human ZAP70. |
Rabbit Polyclonal Lck (Tyr505) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 505 |
Modifications | Phospho-specific |
Rabbit Polyclonal ZAP-70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ZAP-70 |
Rabbit Polyclonal ZAP-70 (Tyr319) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ZAP-70 around the phosphorylation site of Tyrosine 319 |
Modifications | Phospho-specific |
Rabbit Polyclonal ZAP-70 (Tyr493) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ZAP-70 around the phosphorylation site of Tyrosine 493 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-JAK3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE |
Mouse Monoclonal ZAP-70 Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-LCK (aa39-52) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RNGSEVRDPLVTYE, from the internal region (near N Terminus) of the protein sequence according to NP_005347.3. |
Rabbit polyclonal LCK (Ab-59) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human LCK around the phosphorylation site of serine 59 (P-A-SP-P-L). |
Rabbit polyclonal BTK (Tyr551) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human: Tyr551, Mouse: Tyr551, Rat:Tyr552 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 551 (D-E-YP-T-S). |
Modifications | Phospho-specific |
Anti-LCK (phospho-Tyr505) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 505 (G-Q-Y(p)-Q-P) derived from Human Lck. |
Modifications | Phospho-specific |
Mouse monoclonal LCK Antibody(Ascites)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-JAK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF |
Mouse Monoclonal BTK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal BTK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal LCK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti JAK3 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins. |
Rabbit anti p56-LCK (LSK) (pY505) Polyclonal Antibody
Applications | WB |
Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from Carboxyl-terminus of p56lck protein with a phosphorylation site at Tyr 505 from human, rat, bovine and dog origin. |
Rabbit anti p56-LCK (LSK) (Paired Y505) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding –GQYQP- without phosphorylation at tyrosine 505 of p56lck protein from human, rat, bovine, dog origin. |
Rabbit anti p56-LCK (LSK) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from Carboxyl-terminus of p56lck protein from human, rat, bovine, dog origin. |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI12D4 (formerly 12D4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI12H4 (formerly 12H4)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI3D11 (formerly 3D11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI6H9 (formerly 6H9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BTK mouse monoclonal antibody, clone OTI13E5 (formerly 13E5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |