Antibodies

View as table Download

Rabbit anti-CXCR3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CXCR3

Rabbit Polyclonal Anti-OR51E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK

Goat Polyclonal Antibody against HCRTR1

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1.

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.

Rabbit Polyclonal Anti-GPR161 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: SISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLE

Rabbit Polyclonal Anti-CASR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CASR antibody was raised against a 15 amino acid peptide near the amino terminus of human CASR.

Rabbit Polyclonal Anti-TRIP12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRIP12 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human TRIP12.

Rabbit Polyclonal CX3CR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1.

Goat Polyclonal Antibody against Bradykinin receptor B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Rabbit polyclonal anti-SPR1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SPR1.

Rabbit anti-SIGMAR1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIGMAR1

Rabbit Polyclonal Anti-FZD9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit Polyclonal Anti-CALCRL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALCRL antibody: synthetic peptide directed towards the N terminal of human CALCRL. Synthetic peptide located within the following region: DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL

Rabbit polyclonal antibody to GPR4 (G protein-coupled receptor 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 159 and 254 of GPR4 (Uniprot ID#P46093)

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.

Rabbit polyclonal anti-FZD9 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9.

Rabbit polyclonal Encephalopsin antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Encephalopsin.

Rabbit Polyclonal Anti-GPR68 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL

Rabbit Polyclonal Anti-GPR52 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-LOC684623 antibody is: synthetic peptide directed towards the middle region of Rat LOC684623. Synthetic peptide located within the following region: RARFPSHEVDASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESS

Rabbit Polyclonal CCR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3.

Rabbit Polyclonal GPR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPR3 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human GPR3.

Rabbit Polyclonal MC4R Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MC4R antibody was raised against a 19 amino acid peptide near the amino terminus of human MC4R.

Rabbit polyclonal anti-CRHR1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CRHR1.

Rabbit polyclonal CALCR Antibody (C-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR.

Rabbit Polyclonal Anti-FZD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Rabbit Polyclonal Anti-TSHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS

Rabbit Polyclonal Anti-AGTR1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI

Rabbit Polyclonal Anti-GPR6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR6 antibody: synthetic peptide directed towards the N terminal of human GPR6. Synthetic peptide located within the following region: NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV

Rabbit Polyclonal Anti-GPR161 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG

Goat Polyclonal Anti-CB1 (isoform a) Antibody

Applications WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2.

ACKR3 (311-360) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from human CXCR7 (aa311-360)

Rabbit Polyclonal CCR5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5.

Rabbit Polyclonal antibody to Apelin Receptor (apelin receptor)

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a region within amino acids 2 and 96 of Apelin Receptor (Uniprot ID#P35414)

Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726)

Rabbit polyclonal anti-S1PR1/EDG1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EDG1.
Modifications Phospho-specific

Rabbit polyclonal anti-PE2R3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PE2R3.

Rabbit polyclonal anti-EDNRA antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human EDNRA.

Rabbit polyclonal anti-GPRC5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPRC5A.

Rabbit polyclonal anti-SUCNR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SUCNR1.

Rabbit Polyclonal GluR2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR2

Rabbit anti-CHRM5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRM5

Rabbit Polyclonal Anti-GPCR5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY

Rabbit Polyclonal Anti-TSHR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR

Rabbit Polyclonal Anti-NTSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT

Rabbit Polyclonal Anti-CXCR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4

Goat Polyclonal Anti-ADRA1B Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1.