Rabbit Polyclonal Anti-ADIPOQ Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADIPOQ |
Rabbit Polyclonal Anti-ADIPOQ Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADIPOQ |
Rabbit polyclonal anti-MMP-1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-1 antibody. |
Mouse Monoclonal Apolipoprotein A5 Antibody (1G5G9)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MMP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP1 Antibody: A synthesized peptide derived from human MMP1 |
Rabbit anti-OLR1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OLR1 |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Mouse |
Immunogen | Apolipoprotein Type A-I was isolated from mouse plasma by density gradient centrifugation followed by HPLC purification |
Apolipoprotein CIII (APOC3) (N-term) goat polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | APOC3 Recombinant protein from the N-terminus |
Chicken Polyclonal ApoA1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ApoA1 antibody was raised against a 17 amino acid synthetic peptide from near the amino terminus of human ApoA1. The immunogen is located within the first 50 amino acids of ApoA1. |
MMP1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MMP1 |
Rabbit anti-ANGPTL4 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANGPTL4 |
Rabbit anti-PLTP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLTP |
USD 480.00
2 Weeks
Apolipoprotein A II (APOA2) mouse monoclonal antibody, clone 1H6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
Apolipoprotein A II (APOA2) mouse monoclonal antibody, clone 4F3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Apolipoprotein A I (APOA1) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Mouse |
Immunogen | Apo AI isolated from mouse plasma |
Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Human Apo AII |
Angiopoietin like 4 (ANGPTL4) (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 145~175 amino acids from the Center region of human ANGPTL4 |
Rabbit Polyclonal Adiponectin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Adiponectin antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human adiponectin. The immunogen is located within the last 50 amino acids of Adiponectin. |
Rabbit polyclonal anti-APOA5 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOA5. |
Rabbit polyclonal MMP1 (Cleaved-Phe100) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal anti-LOX-1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide near the N-terminus of human Lox-1 |
Rabbit polyclonal MMP1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Mouse Monoclonal anti-MMP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Adiponectin/Acrp30 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal sequence of human Adiponectin (between amino acids 200-244) [UniProt Q15848] |
Rabbit Polyclonal Angiopoietin-like Protein 4/ANGPTL4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal sequence of human ANGPTL4 (within residues 150-250) [UniProt Q9BY76]. |
Adiponectin (ADIPOQ) mouse monoclonal antibody, clone Adn63
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 530.00
2 Weeks
LOX 1 (OLR1) (sLOX-1) mouse monoclonal antibody, clone LOX19-22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Adiponectin (ADIPOQ) mouse monoclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 340.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
USD 230.00
2 Weeks
Apolipoprotein A I (APOA1) (25-267) mouse monoclonal antibody, clone AT1E12, Purified
Applications | ELISA, WB |
Reactivities | Human |
MMP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | MMP1 antibody was raised against a synthetic peptide from near C-terminal of human MMP-1 protein. |
Rabbit Polyclonal Antibody against PLTP
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A partial peptide of human PLTP. |
Rabbit Polyclonal Adiponectin Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Adiponectin antibody was raised against a 15 amino acid peptide from near the amino terminus of human adiponectin. |
Rabbit polyclonal MMP1 (Cleaved-Pro269) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal anti-Angptl4 (FIAF) antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 84 of mouse FIAF |
Rabbit Polyclonal ApoA1 Antibody
Applications | WB |
Reactivities | Chicken, Human |
Conjugation | Unconjugated |
Immunogen | ApoA1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ApoA1. |
Rabbit Polyclonal Anti-APOA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Mouse monoclonal Anti-MMP1 Clone 3B6
Applications | IHC, WB |
Conjugation | Unconjugated |
Rabbit anti MMP-1 (Collagenase-I) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to N-term of human MMP-1. |
Apolipoprotein A I (APOA1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human APOA1 |
Mouse Monoclonal Antibody against Apo A5 (1G5G9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against APOA5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HSLHDQGHSHLGDP, from the C Terminus of the protein sequence according to NP_443200.2. |
Rabbit polyclonal anti-APOA2 antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2. |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI7B11 (formerly 7B11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) APOA5 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) APOA5 mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) APOA5 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
Applications | WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |