Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Rabbit anti-ANPEP Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ANPEP |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
Rabbit Polyclonal Anti-ACE2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE2 Antibody: A synthesized peptide |
USD 450.00
2 Weeks
Goat Polyclonal Antibody against AGTR1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EIQKNKPRNDDIFK, from the internal region of the protein sequence according to NP_000676.1; NP_004826.2; NP_033611.1; NP_114038.1; NP_114438.1. |
USD 380.00
4 Weeks
Mouse Monoclonal Angiotensin Converting Enzyme 1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
USD 440.00
2 Weeks
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
USD 450.00
In Stock
Mouse monoclonal ACE2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 450.00
In Stock
Mouse monoclonal anti-ACE2 (SARS Receptor) antibody (Center)(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII |
Rabbit polyclonal MME Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 721-747 amino acids from the C-terminal region of human MME. |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI |
Rabbit Polyclonal Anti-ANPEP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANPEP antibody: synthetic peptide directed towards the N terminal of human ANPEP. Synthetic peptide located within the following region: VGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLA |
Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
Goat Anti-CD13 / ANPEP (aa79-91) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TLKPDSYRVTLRP, from the internal region (near N terminus) of the protein sequence according to NP_001141.2 |
Goat Anti-CD13 / ANPEP Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLEQFKKDNEET, from the internal region (near C terminus) of the protein sequence according to NP_001141.2 |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MAS1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAS1. Synthetic peptide located within the following region: VTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENGILLW |
Rabbit Polyclonal Anti-AGTR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR2 antibody: synthetic peptide directed towards the N terminal of human AGTR2. Synthetic peptide located within the following region: LHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVT |
Rabbit anti CD10 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to internal region of human CD10 |
Germany
Japan
United Kingdom
China
