c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
Applications | IF, IHC, IP, WB |
c-Myc (MYC) rat monoclonal antibody, clone JAC6, Purified
Applications | IF, IHC, IP, WB |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit monoclonal antibody against APC (EP701Y)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit polyclonal NRAS Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
Rabbit anti-MLH1 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MLH1 |
Rabbit anti-AXIN2 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AXIN2 |
Rabbit anti-AKT1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human AKT1 |
Rabbit anti-CTNNA1 Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal Anti-TCF7L2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Mouse Monoclonal GSK-3 beta Antibody (3D10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal AKT2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone EM-22, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Hamster, Human, Mouse |
E Cadherin (CDH1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 840-880 of Human E-cadherin. |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(Y387)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal Raf1 (Ab-621) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal anti-APC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human APC. |
Mouse Balb/c monoclonal Akt phospho S473 ATTO594 Conjugated antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal AXIN2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AXIN2 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human AXIN2. The immunogen is located within amino acids 780 - 830 of AXIN2. |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human AKT2 |
Rabbit anti-ILK Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ILK |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Rabbit anti-PDPK1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human PDPK1 |
Rabbit anti-GRB2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GRB2 |
Rabbit Polyclonal Anti-EGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit Polyclonal Anti-PI3 kinase P110a Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PI3 kinase P110a Antibody: A synthesized peptide derived from human PI3 kinase P110a |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal MLH1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-CDH1 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
Goat Polyclonal Anti-ERBB2 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. |
Goat Polyclonal Anti-P53 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli. |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
Applications | ELISA, IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified
Applications | ELISA, IF, WB |
Reactivities | Human, Mouse |