Germany
Japan
United Kingdom
China
Antibodies
View as table Download
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit Polyclonal Anti-TPM1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM1 antibody: synthetic peptide directed towards the N terminal of human TPM1. Synthetic peptide located within the following region: DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
USD 340.00
2 Weeks
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Goat Anti-Phospholamban / PLN Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KVQYLTRSAIRR-C, from the N Terminus of the protein sequence according to NP_002658.1. |
Lamin A (LMNA) mouse monoclonal antibody, clone R27, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Fish, Human, Mouse, Rat, Xenopus, Zebrafish |
Rabbit Polyclonal Anti-TPM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TPM2 antibody: synthetic peptide directed towards the C terminal of human TPM2. Synthetic peptide located within the following region: AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL |
USD 405.00
2 Weeks
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, clone G043, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Goat Polyclonal Anti-cardiac troponin T Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Feline, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-cardiac troponin T Antibody: Peptide with sequence C-RNRINDNQKVSKT, from the C Terminus of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Active filters
Applications
- WB
Pathways
- Dilated cardiomyopathy
Filter by
Category
Target Symbol
- TNNI3 (55)
- TNNT2 (55)
- GNAS (46)
- ACTB (38)
- TNF (38)
- LMNA (35)
- SHC1 (32)
- IGF1 (27)
- DES (19)
- TGFB1 (18)
- CACNB2 (17)
- ITGB1 (17)
- TNNC1 (16)
- ITGB3 (14)
- CACNB1 (12)
- SGCD (9)
- TPM1 (9)
- ATP2A2 (8)
- ITGA4 (8)
- PRKACA (8)
- TPM2 (8)
- ACTG1 (7)
- ITGAV (7)
- ITGB4 (7)
- ITGA5 (6)
- ITGA6 (6)
- MYL2 (6)
- CACNB4 (5)
- EMD (5)
- ITGB5 (5)
- ITGB6 (5)
- TGFB2 (5)
- TGFB3 (5)
- ADRB1 (4)
- CACNG1 (4)
- ITGA3 (4)
- MYL3 (4)
- PRKACB (4)
- ADCY1 (3)
- ADCY2 (3)
- CACNA2D1 (3)
- CACNA2D2 (3)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG4 (3)
- CACNG5 (3)
- CACNG6 (3)
- DMD (3)
- ITGA2 (3)
- ITGA2B (3)
- PLN (3)
- PRKX (3)
- SGCB (3)
- TPM4 (3)
- ACTC1 (2)
- ADCY3 (2)
- ADCY4 (2)
- ADCY5 (2)
- ADCY6 (2)
- CACNA1C (2)
- DAG1 (2)
- ITGA1 (2)
- ITGA8 (2)
- ITGB7 (2)
- SGCG (2)
- TPM3 (2)
- ADCY8 (1)
- ADCY9 (1)
- CACNA1S (1)
- CACNA2D3 (1)
- CACNG3 (1)
- CACNG7 (1)
- CACNG8 (1)
- ITGA11 (1)
- ITGA7 (1)
- ITGB8 (1)
- MYBPC3 (1)
- MYH6 (1)
- PARVG (1)
- PRKACG (1)
- RYR2 (1)
- SGCA (1)
- SLC8A1 (1)
Reactivities
- Human (562)
- Mouse (404)
- Rat (361)
- Dog (26)
- Monkey (17)
- Bovine (12)
- Pig (12)
- Cow (11)
- Chicken (8)
- Rabbit (8)
- Drosophila (4)
- Canine (3)
- Hamster (3)
- X. tropicalis (3)
- Zebrafish (3)
- Chimpanzee (2)
- Feline (2)
- Porcine (2)
- Primate (2)
- Xenopus (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Goat (1)
- Guinea Pig (1)
- Rhesus Monkey (1)
- Sheep (1)