Germany
Japan
United Kingdom
China
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Antibodies
View as table Download
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GALNS (galactosamine (N-acetyl)-6-sulfate sulfatase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 20 and 259 of GALNS |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-OAT antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human OAT. |
Rabbit Polyclonal Anti-INPP5K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
Rabbit anti-LIPC Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LIPC |
Goat Anti-IDS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal FASN Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN. |
Rabbit Polyclonal Anti-GPT Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPT antibody: synthetic peptide directed towards the N terminal of human GPT. Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-NME7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal FALDH Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Polyclonal Antibody against TUSC3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit polyclonal iNOS (Ab-151) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human iNOS around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S). |
Rabbit Polyclonal Anti-NFKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKB1 |
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human BACE1 |
Rabbit Polyclonal Anti-ALAS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ALAS2 |
Goat Polyclonal Antibody against OGT
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-YEHPKDLKLSDGR, from the internal region of the protein sequence according to NP_858058.1; NP_858059.1. |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Metabolic pathways
Availabilities
- In Stock
Filter by
Category
Target Symbol
- NFKB1 (9)
- NOS3 (8)
- TH (7)
- AKR1B1 (5)
- PLCG1 (5)
- ACACA (4)
- AK1 (4)
- ALDH3B1 (4)
- ALDOB (4)
- AMD1 (4)
- CYP19A1 (4)
- GPT (4)
- NOS2 (4)
- AKR1A1 (3)
- AKR1B10 (3)
- ALDH1A2 (3)
- ALDH4A1 (3)
- ALDH9A1 (3)
- ALDOA (3)
- ALOX5 (3)
- AOX1 (3)
- CYP11A1 (3)
- CYP2E1 (3)
- GAD1 (3)
- GK (3)
- PC (3)
- PCK1 (3)
- PKM (3)
- PTGS1 (3)
- TPH2 (3)
- ACLY (2)
- ACO1 (2)
- ACOX1 (2)
- ADH1B (2)
- ADH4 (2)
- AKR1D1 (2)
- ALAS2 (2)
- ALDH1A1 (2)
- ALDH1B1 (2)
- ALDH3A1 (2)
- ALDH3A2 (2)
- ALDH5A1 (2)
- ALDH6A1 (2)
- ALPL (2)
- AMPD1 (2)
- ARG1 (2)
- ASS1 (2)
- CAD (2)
- CAT (2)
- CBR1 (2)
- CBS (2)
- CKM (2)
- CYP11B1 (2)
- CYP1A2 (2)
- CYP27A1 (2)
- CYP2B6 (2)
- CYP3A4 (2)
- CYP4A11 (2)
- DGKB (2)
- DNMT1 (2)
- DNMT3A (2)
- ENO1 (2)
- ENPP3 (2)
- FASN (2)
- GAD2 (2)
- GALK1 (2)
- GBA (2)
- GCK (2)
- GNE (2)
- HK1 (2)
- HPRT1 (2)
- MVK (2)
- NDUFV2 (2)
- NME2 (2)
- NME3 (2)
- NOS1 (2)
- PFKL (2)
- PFKP (2)
- PLCG2 (2)
- PON1 (2)
- PRPS1 (2)
- RRM1 (2)
- TAT (2)
- TBXAS1 (2)
- TK1 (2)
- TPH1 (2)
- UQCRC1 (2)
- A4GALT (1)
- AASS (1)
- ACADS (1)
- ACADVL (1)
- ACSL4 (1)
- ADA (1)
- ADH1A (1)
- ADSL (1)
- AGXT (1)
- AHCY (1)
- AK2 (1)
- AK5 (1)
- AKR1C4 (1)