Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-TDO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Active filters
Reactivities
- Human
Clonalities
- Polyclonal
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (26)
- MAPT (19)
- AKT1 (18)
- TP53 (16)
- JUN (15)
- EZR (14)
- ATF2 (13)
- BRCA1 (13)
- CD44 (13)
- NR3C1 (13)
- RELA (13)
- BRAF (12)
- CHEK1 (12)
- EIF4EBP1 (12)
- IRS1 (11)
- PDGFRB (11)
- PRKCD (11)
- CREB1 (10)
- FGFR1 (10)
- FOXO1 (10)
- IKBKG (10)
- MET (10)
- PAK1 (10)
- RPS6KB1 (10)
- SRC (10)
- ERBB2 (9)
- ESR1 (9)
- GRIN2B (9)
- MAP2K1 (9)
- MAPK14 (9)
- MDM2 (9)
- NFKB1 (9)
- RAF1 (9)
- BRCA2 (8)
- CCNB1 (8)
- CDC25A (8)
- CHUK (8)
- CSF1R (8)
- CTNNB1 (8)
- FN1 (8)
- GSK3A (8)
- IGF1R (8)
- JAK2 (8)
- MTOR (8)
- NOS3 (8)
- PPP1R1B (8)
- PRKCA (8)
- PTK2 (8)
- RUNX1 (8)
- SNCA (8)
- STAT5A (8)
- SYK (8)
- YWHAZ (8)
- ABL1 (7)
- ATF4 (7)
- BAD (7)
- CASP7 (7)
- CASP9 (7)
- CDH1 (7)
- CDK2 (7)
- CFLAR (7)
- EPHA2 (7)
- GAPDH (7)
- HDAC2 (7)
- MAP2K4 (7)
- MAPK3 (7)
- NFKBIA (7)
- PTPN11 (7)
- RPS6KA5 (7)
- SMAD1 (7)
- STAT1 (7)
- TH (7)
- ACTB (6)
- AGT (6)
- APP (6)
- BAX (6)
- BCL2L1 (6)
- CAMK2A (6)
- CASP3 (6)
- CCNE1 (6)
- CD19 (6)
- CTSD (6)
- DPYSL2 (6)
- ELK1 (6)
- GCG (6)
- GDF15 (6)
- GJA1 (6)
- HDAC1 (6)
- HDAC4 (6)
- HSF1 (6)
- HSPD1 (6)
- IKBKB (6)
- INSR (6)
- JUND (6)
- MAPK8 (6)
- MYB (6)
- NFKB2 (6)
- NGFR (6)
- PAK2 (6)
- POMC (6)
Applications
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (5829)
- Transmembrane (2371)
- Transcription Factors (1294)
- Protein Kinase (901)
- Secreted Protein (821)
- ES Cell Differentiation/IPS (624)
- Stem cell - Pluripotency (374)
- Protease (327)
- GPCR (293)
- Adult stem cells (134)
- Phosphatase (115)
- Stem cell relevant signaling - JAK/STAT signaling pathway (95)
- Embryonic stem cells (94)
- Cancer stem cells (93)
- Nuclear Hormone Receptor (76)
- Ion Channels: Other (65)
- P450 (55)
- Induced pluripotent stem cells (52)
- Stem cell relevant signaling - DSL/Notch pathway (50)
- Ion Channels: Potassium (43)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (33)
- Ion Channels: Glutamate Receptors (32)
- Ion Channels: Transient receptor potential (28)
- Stem cell relevant signaling - Wnt Signaling pathway (28)
- Ion Channels: Cys-loop Receptors (17)
- Ion Channels: Sodium (15)
- Ion Channels: Cyclic nucleotide gated (7)
- Ion Channels: Calcium (6)
- Ion Channels: ATP Receptors (1)
Pathways
- Pathways in cancer (855)
- Metabolic pathways (614)
- MAPK signaling pathway (601)
- Focal adhesion (476)
- Neurotrophin signaling pathway (392)
- Regulation of actin cytoskeleton (381)
- Prostate cancer (377)
- Chemokine signaling pathway (350)
- ErbB signaling pathway (344)
- Cytokine-cytokine receptor interaction (311)
- Chronic myeloid leukemia (308)
- Insulin signaling pathway (308)
- Colorectal cancer (297)
- Pancreatic cancer (290)
- Neuroactive ligand-receptor interaction (284)
- T cell receptor signaling pathway (283)
- Cell cycle (273)
- Endocytosis (268)
- Apoptosis (251)
- Melanoma (250)
- Small cell lung cancer (247)
- Wnt signaling pathway (247)
- Alzheimer's disease (245)
- Toll-like receptor signaling pathway (245)
- Glioma (244)
- Calcium signaling pathway (243)
- Acute myeloid leukemia (240)
- Leukocyte transendothelial migration (237)
- GnRH signaling pathway (229)
- Fc gamma R-mediated phagocytosis (228)
- B cell receptor signaling pathway (225)
- Jak-STAT signaling pathway (224)
- Progesterone-mediated oocyte maturation (220)
- Adherens junction (214)
- Non-small cell lung cancer (212)
- Natural killer cell mediated cytotoxicity (208)
- Adipocytokine signaling pathway (206)
- Axon guidance (206)
- Endometrial cancer (206)
- Huntington's disease (199)
- Epithelial cell signaling in Helicobacter pylori infection (198)
- Oocyte meiosis (195)
- Renal cell carcinoma (191)
- VEGF signaling pathway (191)
- Fc epsilon RI signaling pathway (190)
- Tight junction (182)
- Melanogenesis (178)
- p53 signaling pathway (178)
- Bladder cancer (177)
- Gap junction (173)
- Vascular smooth muscle contraction (164)
- Amyotrophic lateral sclerosis (ALS) (158)
- mTOR signaling pathway (150)
- Long-term potentiation (148)
- NOD-like receptor signaling pathway (147)
- RIG-I-like receptor signaling pathway (135)
- Ubiquitin mediated proteolysis (132)
- Pathogenic Escherichia coli infection (131)
- Cell adhesion molecules (CAMs) (124)
- TGF-beta signaling pathway (124)
- Long-term depression (120)
- Olfactory transduction (119)
- Type II diabetes mellitus (117)
- Parkinson's disease (112)
- Hematopoietic cell lineage (107)
- Thyroid cancer (93)
- ECM-receptor interaction (92)
- Dilated cardiomyopathy (91)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (88)
- Cytosolic DNA-sensing pathway (88)
- Hypertrophic cardiomyopathy (HCM) (88)
- Basal cell carcinoma (84)
- Viral myocarditis (80)
- PPAR signaling pathway (77)
- Complement and coagulation cascades (76)
- Purine metabolism (76)
- Glycolysis / Gluconeogenesis (71)
- Prion diseases (66)
- Dorso-ventral axis formation (65)
- Systemic lupus erythematosus (63)
- Oxidative phosphorylation (61)
- Lysosome (60)
- Vibrio cholerae infection (60)
- Antigen processing and presentation (58)
- Phosphatidylinositol signaling system (58)
- Arginine and proline metabolism (53)
- Notch signaling pathway (53)
- Hedgehog signaling pathway (52)
- ABC transporters (50)
- Drug metabolism - cytochrome P450 (48)
- Primary immunodeficiency (48)
- Metabolism of xenobiotics by cytochrome P450 (47)
- Cardiac muscle contraction (43)
- Glycerolipid metabolism (42)
- Ribosome (42)
- Spliceosome (41)
- Tyrosine metabolism (40)
- Arachidonic acid metabolism (38)
- Pyrimidine metabolism (38)
- Pyruvate metabolism (37)
- Homologous recombination (36)
- Tryptophan metabolism (36)
- Type I diabetes mellitus (36)
- Base excision repair (35)
- Fructose and mannose metabolism (35)
- Retinol metabolism (35)
- Alanine (33)
- Nucleotide excision repair (33)
- Taste transduction (33)
- aspartate and glutamate metabolism (33)
- Fatty acid metabolism (32)
- Inositol phosphate metabolism (32)
- Valine (32)
- leucine and isoleucine degradation (30)
- Butanoate metabolism (29)
- DNA replication (29)
- Renin-angiotensin system (28)
- SNARE interactions in vesicular transport (28)
- Regulation of autophagy (27)
- Histidine metabolism (26)
- Proteasome (26)
- Cysteine and methionine metabolism (25)
- Glycerophospholipid metabolism (25)
- Citrate cycle (TCA cycle) (24)
- Glutathione metabolism (24)
- Graft-versus-host disease (24)
- Mismatch repair (24)
- Starch and sucrose metabolism (24)
- Androgen and estrogen metabolism (23)
- Nitrogen metabolism (23)
- Pentose phosphate pathway (23)
- Autoimmune thyroid disease (22)
- Lysine degradation (22)
- Allograft rejection (21)
- RNA degradation (21)
- Basal transcription factors (20)
- Galactose metabolism (20)
- Maturity onset diabetes of the young (20)
- Amino sugar and nucleotide sugar metabolism (19)
- Drug metabolism - other enzymes (18)
- Linoleic acid metabolism (18)
- Non-homologous end-joining (18)
- Propanoate metabolism (18)
- Biosynthesis of unsaturated fatty acids (17)
- Primary bile acid biosynthesis (17)
- beta-Alanine metabolism (17)
- Ether lipid metabolism (15)
- N-Glycan biosynthesis (15)
- Phenylalanine metabolism (15)
- Sphingolipid metabolism (15)
- Glycine (14)
- Porphyrin and chlorophyll metabolism (14)
- serine and threonine metabolism (14)
- Asthma (13)
- C21-Steroid hormone metabolism (13)
- Limonene and pinene degradation (13)
- Ascorbate and aldarate metabolism (12)
- Riboflavin metabolism (11)
- Taurine and hypotaurine metabolism (11)
- Aminoacyl-tRNA biosynthesis (10)
- Folate biosynthesis (10)
- Nicotinate and nicotinamide metabolism (10)
- Pentose and glucuronate interconversions (10)
- alpha-Linolenic acid metabolism (9)
- Selenoamino acid metabolism (8)
- Glycosaminoglycan degradation (7)
- Glyoxylate and dicarboxylate metabolism (7)
- Other glycan degradation (7)
- Terpenoid backbone biosynthesis (7)
- Caffeine metabolism (6)
- Chondroitin sulfate biosynthesis (6)
- Fatty acid biosynthesis (6)
- One carbon pool by folate (6)
- Phenylalanine (6)
- RNA polymerase (6)
- Steroid biosynthesis (6)
- tyrosine and tryptophan biosynthesis (6)
- Heparan sulfate biosynthesis (5)
- Pantothenate and CoA biosynthesis (5)
- Circadian rhythm - mammal (4)
- Glycosphingolipid biosynthesis - ganglio series (4)
- Glycosphingolipid biosynthesis - lacto and neolacto series (4)
- Keratan sulfate biosynthesis (4)
- Lysine biosynthesis (4)
- Methane metabolism (4)
- O-Glycan biosynthesis (4)
- Synthesis and degradation of ketone bodies (4)
- leucine and isoleucine biosynthesis (4)
- Cyanoamino acid metabolism (3)
- D-Glutamine and D-glutamate metabolism (3)
- Fatty acid elongation in mitochondria (3)
- Sulfur metabolism (3)
- Vitamin B6 metabolism (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Protein export (2)
- Thiamine metabolism (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- Glycosphingolipid biosynthesis - globo series (1)
- O-Mannosyl glycan biosynthesis (1)