Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 428.00
In Stock
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-HSBP1 antibody for SISCAPA, clone OTIR5C4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-IASPP antibody for SISCAPA, clone OTIR1G11
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Active filters
Families
- Transcription Factors
Availabilities
- In Stock
Filter by
Target Symbol
- TP53 (83)
- JUN (74)
- PGR (68)
- GLI1 (62)
- MAP2K3 (62)
- CTNNB1 (53)
- MDM2 (52)
- NKX3-1 (46)
- NKX2-1 (36)
- CBX8 (35)
- MDM4 (34)
- ERG (33)
- NR3C1 (31)
- SNAI2 (29)
- UBA52 (29)
- MEF2C (28)
- CD80 (27)
- ESR1 (27)
- FOXO1 (27)
- TLE1 (27)
- SLA2 (26)
- BHLHE41 (25)
- BRCA1 (24)
- FOS (24)
- MCM2 (24)
- TNF (24)
- GATA3 (23)
- HDAC4 (23)
- STAT5A (23)
- FOSB (22)
- NAB1 (22)
- PRRX1 (22)
- CNOT4 (21)
- ESRRA (21)
- NEUROG1 (21)
- RB1 (21)
- ZEB1 (21)
- FOXI1 (20)
- PARN (20)
- SKIL (20)
- ZNF69 (20)
- ZSCAN18 (20)
- CLOCK (19)
- ELF4 (19)
- HDAC9 (19)
- HSF2 (19)
- NR2C1 (19)
- NR2E3 (19)
- RYBP (19)
- STAT4 (19)
- TCF12 (19)
- CD86 (18)
- CDX2 (18)
- FOXO4 (18)
- MEOX1 (18)
- MRTFA (18)
- NAB2 (18)
- NFKBIE (18)
- NR1I3 (18)
- NR2C2 (18)
- NR4A3 (18)
- SMAD1 (18)
- TET3 (18)
- TSC22D1 (18)
- ZFP37 (18)
- ZSCAN4 (18)
- ATF1 (17)
- BTG2 (17)
- ELL (17)
- FOXP3 (17)
- HOXC10 (17)
- IKBKG (17)
- LHX2 (17)
- MED15 (17)
- MYC (17)
- RARA (17)
- TP53BP1 (17)
- AR (16)
- BCL6 (16)
- ELF3 (16)
- GCM1 (16)
- HES1 (16)
- IRF3 (16)
- PDX1 (16)
- SOX17 (16)
- SQSTM1 (16)
- TCEAL1 (16)
- TCEANC2 (16)
- TGIF1 (16)
- TRIM24 (16)
- UBP1 (16)
- ZNF200 (16)
- ZNF35 (16)
- ZSCAN21 (16)
- HDAC6 (15)
- KLF2 (15)
- HDAC10 (14)
- HDAC8 (14)
- LHX1 (14)
- MORF4 (14)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (769)
- MAPK signaling pathway (475)
- Prostate cancer (388)
- Chronic myeloid leukemia (316)
- Toll-like receptor signaling pathway (314)
- Cell cycle (306)
- Wnt signaling pathway (303)
- Colorectal cancer (278)
- Neurotrophin signaling pathway (264)
- T cell receptor signaling pathway (216)
- Basal cell carcinoma (204)
- Pancreatic cancer (202)
- Small cell lung cancer (194)
- p53 signaling pathway (187)
- Bladder cancer (185)
- B cell receptor signaling pathway (184)
- Amyotrophic lateral sclerosis (ALS) (176)
- Endometrial cancer (176)
- Thyroid cancer (175)
- Apoptosis (166)
- Huntington's disease (165)
- Melanoma (165)
- Glioma (161)
- GnRH signaling pathway (154)
- TGF-beta signaling pathway (154)
- Acute myeloid leukemia (149)
- ErbB signaling pathway (143)
- Focal adhesion (140)
- Ubiquitin mediated proteolysis (128)
- Adipocytokine signaling pathway (126)
- Non-small cell lung cancer (125)
- Epithelial cell signaling in Helicobacter pylori infection (122)
- Renal cell carcinoma (119)
- Jak-STAT signaling pathway (108)
- Adherens junction (104)
- Oocyte meiosis (103)
- Chemokine signaling pathway (100)
- RIG-I-like receptor signaling pathway (94)
- Fc epsilon RI signaling pathway (90)
- Systemic lupus erythematosus (79)
- Cytosolic DNA-sensing pathway (77)
- Maturity onset diabetes of the young (77)
- Allograft rejection (76)
- Graft-versus-host disease (76)
- Melanogenesis (76)
- Type I diabetes mellitus (76)
- NOD-like receptor signaling pathway (75)
- Endocytosis (74)
- Tight junction (70)
- Progesterone-mediated oocyte maturation (68)
- Circadian rhythm - mammal (67)
- Hedgehog signaling pathway (63)
- Metabolic pathways (63)
- Leukocyte transendothelial migration (62)
- Pathogenic Escherichia coli infection (62)
- Insulin signaling pathway (60)
- Viral myocarditis (60)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (58)
- RNA degradation (53)
- Autoimmune thyroid disease (52)
- Cell adhesion molecules (CAMs) (52)
- Notch signaling pathway (49)
- Neuroactive ligand-receptor interaction (47)
- Type II diabetes mellitus (46)
- Purine metabolism (43)
- Pyrimidine metabolism (43)
- Natural killer cell mediated cytotoxicity (41)
- Basal transcription factors (40)
- Alzheimer's disease (39)
- RNA polymerase (39)
- Cytokine-cytokine receptor interaction (37)
- DNA replication (34)
- Antigen processing and presentation (33)
- Dilated cardiomyopathy (32)
- Hypertrophic cardiomyopathy (HCM) (32)
- Ribosome (29)
- PPAR signaling pathway (27)
- Primary immunodeficiency (27)
- Asthma (24)
- Hematopoietic cell lineage (24)
- Nucleotide excision repair (24)
- Base excision repair (22)
- Axon guidance (20)
- Dorso-ventral axis formation (19)
- Long-term potentiation (16)
- Proteasome (13)
- VEGF signaling pathway (13)
- mTOR signaling pathway (12)
- Fc gamma R-mediated phagocytosis (8)
- Lysine degradation (8)
- Long-term depression (7)
- Regulation of actin cytoskeleton (7)
- Prion diseases (6)
- Calcium signaling pathway (4)
- Cysteine and methionine metabolism (4)
- Non-homologous end-joining (4)
- Vascular smooth muscle contraction (4)
- Glycolysis / Gluconeogenesis (2)
- Homologous recombination (2)
- Spliceosome (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Biosynthesis of unsaturated fatty acids (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- serine and threonine metabolism (1)