IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700023 |
IL6 rat monoclonal antibody, ELISA and Luminex validated, clone OTI13A5
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700023 |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IL1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL1A |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
USD 524.00
In Stock
Rabbit Monoclonal Antibody against PRNP (Clone EP1802Y)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Anti-Human IL-1 beta Purified (50 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit anti-SOD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD1 |
STIP1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STIP1 |
Rabbit anti-PRNP Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRNP |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
HSPA1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3C6
Applications | ELISA, LMNX |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700030 |
Rabbit anti-PRKACB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PRKACB |
Rabbit Polyclonal Anti-MAP2K1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP2K1 |
Rabbit polyclonal anti-GRP78 / HSPA5 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GRP78. |
Rabbit polyclonal anti-LAMC1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Rabbit polyclonal Hsp70 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
Conjugation | Unconjugated |
Immunogen | Full length human protein Hsp70 |
BIP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BIP |
Rabbit anti-MEK1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human MEK1 |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
MAPK1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6F8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700062 |
Prion protein PrP (PRNP) mouse monoclonal antibody, clone EM-20, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to STIP1 (stress-induced-phosphoprotein 1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 300 of STIP1 (Uniprot ID#P31948) |
Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Notch 1. |
Rabbit Polyclonal Anti-C1QA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QA antibody: synthetic peptide directed towards the N terminal of human C1QA. Synthetic peptide located within the following region: PGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGG |
Rabbit Polyclonal Anti-LAMC1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit Polyclonal anti-HSPA5 Antibody
Applications | WB |
Reactivities | Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Fungus, Cow |
Conjugation | Unconjugated |
Immunogen | Rat GRP78 (Bip) sythetic peptide conjugated to KLH |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
IL1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL1A |
Mouse Monoclonal BiP/GRP78 (C-terminus) Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Anti-BAX Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 90 aa to the N-terminus of human BAX produced in E. coli. |
Rabbit Monoclonal antibody against STIP1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
Modifications | Phospho-specific |
CCL5 / RANTES Mouse Monoclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal C1QC Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-120 amino acids from the Central region of human C1QC. |
Rabbit polyclonal C1QB Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This C1QB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 55-81 amino acids from the N-terminal region of human C1QB. |
Mouse monoclonal Hsp70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Canine, Chicken, Drosophilia, Carp, Guinea pig, Hamster, Monkey, Pig, Rabbit, Sheep |
Conjugation | Unconjugated |
Rabbit anti-HSPA1A Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | N term –peptide of human HSPA1A |
Rabbit anti-CCL5 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-LAMC1 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: KTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAE |
Rabbit Polyclonal Anti-C8G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
HSP70-1A (HSPA1A) mouse monoclonal antibody, clone SJ-70, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to C5 (complement component 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1223 and 1451 of C5 (Uniprot ID#P01031) |