Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Rabbit polyclonal anti-HER3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HER3 whole rabbit serum was prepared by repeated immunizations with a HER3 fusion protein corresponding to amino acids 1283 to 1323 (40 amino acids) at the carboxy-terminus of human HER3. |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 340.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
USD 125.00
2 Weeks
EGFR (Extracell. non Ligand binding Site) mouse monoclonal antibody, clone EGF-R2, Purified
| Applications | Assay, ELISA, FC, IHC |
| Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700471 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700469 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700472 |
purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7
| Applications | LMNX |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700473 |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 355.00
2 Weeks
EGFR (Ligand binding Site) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
EGFR (Ligand bdg. Dom.) mouse monoclonal antibody, clone EGF-R1, Purified
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
