Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
TGFBI Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%). |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
ILEI / FAM3C Rabbit Polyclonal (aa40-80) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Human, Monkey, Mouse, Opossum, Rat, Dog, Pufferfish |
| Conjugation | Unconjugated |
| Immunogen | ILEI / FAM3C antibody was raised against synthetic peptide from human FAM3C. |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
WNT2B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%). |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Mouse Monoclonal VEGF Antibody (VG76e)
| Applications | IHC, WB |
| Reactivities | Human, Bovine, Porcine, Sheep |
| Conjugation | Unconjugated |
Rabbit Polyclonal Lactoperoxidase Antibody
| Applications | WB |
| Reactivities | Human, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of the human Lactoperoxidase protein (within residues 300-400). [Swiss-Prot# P22079] |
Rabbit Polyclonal antibody to SNTB2 (syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 174 and 540 of SNTB2 (Uniprot ID#Q13425) |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697) |
PACE4 / PCSK6 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | PACE4 / PCSK6 antibody was raised against synthetic peptide PDCEPGTYFDSE from an internal region of human PCSK6 / PACE4 (NP_002561.1; NP_612192.1; NP_612195.1; NP_612197.1; NP_612196.1; NP_612198.2; NP_612193.1; NP_612194.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Panda (92%); Platypus, Poplar (83%). |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit polyclonal antibody to Cartilage-associated protein (cartilage associated protein)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 363 of Cartilage-associated protein (Uniprot ID#O75718) |
Rabbit polyclonal antibody to alpha 2A amylase(pancreatic) (amylase, alpha 2A (pancreatic))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 430 of alpha amylase 2A (pancreatic) (Uniprot ID#P04746) |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 800-900). [UniProt# Q14114] |
Rabbit Polyclonal Lactoperoxidase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Goat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human Lactoperoxidase protein (within residues 650-712). [Swiss-Prot# P22079] |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Mouse anti Laminin Monoclonal Antibody
| Reactivities | Bovine, Chicken, Human, Rat |
| Conjugation | Unconjugated |
Rabbit anti Neuropilin-1 (pT916) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –LNTQS- with a phosphorylation site at Thr916. This sequence is identical among human and bovine. |
Rabbit anti Neuropilin-1 (Paired T916) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –LNTQS- without phosphorylation site at Thr916. This sequence is identical among human and bovine. |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 3A6
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 8E2
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Active filters
Filter by
Target Symbol
- GNAS (3)
- INS (3)
- NRP1 (3)
- WNT10A (3)
- AGR2 (2)
- CALR (2)
- LPO (2)
- SFN (2)
- WNT11 (2)
- WNT4 (2)
- ADAMTS1 (1)
- ADAMTS5 (1)
- ADAMTSL2 (1)
- ADCK1 (1)
- AGR3 (1)
- AMPH (1)
- AMY2A (1)
- BMP10 (1)
- C2 (1)
- CA11 (1)
- CRTAP (1)
- DKK3 (1)
- DPP4 (1)
- ENTPD6 (1)
- F13A1 (1)
- F9 (1)
- FAM3C (1)
- IGFBP2 (1)
- IGFBP5 (1)
- IL16 (1)
- INHBA (1)
- LAMB1 (1)
- LOX (1)
- LRP8 (1)
- MUC1 (1)
- PCSK6 (1)
- PLA2G12A (1)
- PLA2G3 (1)
- PNLIP (1)
- SEMA3B (1)
- SERPINF2 (1)
- SNTB2 (1)
- TGFBI (1)
- TIMP4 (1)
- TNFRSF1A (1)
- VAMP1 (1)
- VEGFA (1)
- WNT1 (1)
- WNT16 (1)
- WNT2 (1)
- WNT2B (1)
- WNT5A (1)
- WNT6 (1)
- WNT7A (1)
- WNT8A (1)
- WNT9A (1)
- WNT9B (1)
- ZPBP (1)
Antibody Hosts
Clonalities
Conjugates
Pathways
- Melanogenesis (20)
- Pathways in cancer (19)
- Basal cell carcinoma (17)
- Hedgehog signaling pathway (17)
- Wnt signaling pathway (17)
- GnRH signaling pathway (5)
- Long-term depression (5)
- Vascular smooth muscle contraction (5)
- Axon guidance (4)
- Complement and coagulation cascades (4)
- Metabolic pathways (4)
- mTOR signaling pathway (4)
- Calcium signaling pathway (3)
- Cytokine-cytokine receptor interaction (3)
- Dilated cardiomyopathy (3)
- Gap junction (3)
- Insulin signaling pathway (3)
- MAPK signaling pathway (3)
- Maturity onset diabetes of the young (3)
- Oocyte meiosis (3)
- Progesterone-mediated oocyte maturation (3)
- Prostate cancer (3)
- Regulation of actin cytoskeleton (3)
- Regulation of autophagy (3)
- Taste transduction (3)
- Type I diabetes mellitus (3)
- Type II diabetes mellitus (3)
- VEGF signaling pathway (3)
- Vibrio cholerae infection (3)
- Antigen processing and presentation (2)
- Arachidonic acid metabolism (2)
- Cell cycle (2)
- Ether lipid metabolism (2)
- Fc epsilon RI signaling pathway (2)
- Focal adhesion (2)
- Glycerophospholipid metabolism (2)
- Linoleic acid metabolism (2)
- alpha-Linolenic acid metabolism (2)
- p53 signaling pathway (2)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Bladder cancer (1)
- ECM-receptor interaction (1)
- Fc gamma R-mediated phagocytosis (1)
- Glycerolipid metabolism (1)
- Pancreatic cancer (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Renal cell carcinoma (1)
- SNARE interactions in vesicular transport (1)
- Small cell lung cancer (1)
- Starch and sucrose metabolism (1)
- Systemic lupus erythematosus (1)
- TGF-beta signaling pathway (1)