Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
N-cadherin Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human N-cadherin |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the middle region of human DES. Synthetic peptide located within the following region: MALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKT |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit anti-PKP2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PKP2 |
Rabbit polyclonal ITGB4 (Ab-1510) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit anti-JUP Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human JUP |
Rabbit Polyclonal Anti-DES Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DES antibody: synthetic peptide directed towards the N terminal of human DES. Synthetic peptide located within the following region: PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal Anti-CDH2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDH2 Antibody: A synthesized peptide derived from human CDH2 |
Chicken Polyclonal Anti-Beta-actin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Beta-actin antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human beta-actin. |
USD 379.00
In Stock
Goat Polyclonal Anti-LMNA Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 620 aa to C-term of human LMNA produced in E. coli. |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229) |
Mouse Monoclonal anti-CACNB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Filter by
Target Symbol
- CTNNB1 (144)
- CDH2 (39)
- DES (31)
- SHC1 (29)
- ACTB (27)
- LMNA (24)
- ITGB3 (19)
- JUP (18)
- ITGB1 (15)
- GJA1 (13)
- ACTN1 (10)
- CTNNA1 (9)
- ATP2A2 (8)
- LEF1 (8)
- SGCD (7)
- CACNB1 (6)
- ITGB6 (6)
- ACTG1 (5)
- ITGAV (5)
- ITGB4 (5)
- DSP (4)
- ITGA4 (4)
- ITGB5 (4)
- ACTN2 (3)
- ACTN3 (3)
- ACTN4 (3)
- CACNB2 (3)
- CACNB4 (3)
- DMD (3)
- ITGA6 (3)
- TCF7 (3)
- CACNA1C (2)
- CACNG1 (2)
- EMD (2)
- ITGA2B (2)
- ITGA5 (2)
- ITGA7 (2)
- PKP2 (2)
- SGCA (2)
- CACNA1D (1)
- CACNA1S (1)
- CACNA2D2 (1)
- CACNA2D3 (1)
- CACNA2D4 (1)
- CACNG3 (1)
- CACNG5 (1)
- CACNG6 (1)
- CACNG7 (1)
- CTNNA3 (1)
- DAG1 (1)
- DSC2 (1)
- ITGA11 (1)
- ITGA2 (1)
- ITGA3 (1)
- ITGB7 (1)
- LAMA2 (1)
- RYR2 (1)
- TCF7L1 (1)