Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit polyclonal anti-ST6GAL1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1. |
Goat Polyclonal Antibody against TUSC3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQRQCSVCRQAN, from the internal region of the protein sequence according to NP_006756.2; NP_839952.1. |
Rabbit Polyclonal antibody to MGAT3 (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 260 and 525 of MGAT3 (Uniprot ID#Q09327) |
Rabbit polyclonal anti-B4GALT1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
Rabbit Polyclonal Ribophorin II Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal anti-B4GALT3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT3. |
Rabbit Polyclonal Anti-ALG2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG2 antibody: synthetic peptide directed towards the C terminal of human ALG2. Synthetic peptide located within the following region: QSDLGQYVTFLRSFSDKQKISLLHSCTCVLYTPSNEHFGIVPLEAMYMQC |
Rabbit Polyclonal Anti-MAN1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAN1B1 Antibody: A synthesized peptide derived from human MAN1B1 |
Rabbit Polyclonal Anti-TUSC3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUSC3 Antibody: A synthesized peptide derived from human TUSC3 |
Rabbit Polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 47 and 251 of alpha Glucosidase II |
Goat Anti-MGAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVEKVRTNDR, from the internal region of the protein sequence according to NP_002397.2. |
Rabbit polyclonal anti-MAN1B1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAN1B1. |
Goat Polyclonal Antibody against MAN2A1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KISSDIKSQNR, from the internal region of the protein sequence according to NP_002363.2. |
Rabbit Polyclonal DAD1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DAD1 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human DAD1. |
Rabbit polyclonal antibody to MAN1B1 (mannosidase, alpha, class 1B, member 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 414 and 699 of MAN1B1 (Uniprot ID#Q9UKM7) |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Rabbit polyclonal anti-TUSC3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TUSC3. |
Rabbit polyclonal Anti-ALG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG1 antibody: synthetic peptide directed towards the N terminal of human ALG1. Synthetic peptide located within the following region: VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG |
Rabbit Polyclonal Anti-GANAB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GANAB Antibody: synthetic peptide directed towards the middle region of human GANAB. Synthetic peptide located within the following region: IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL |
Rabbit Polyclonal Anti-ALG11 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the C terminal of human ALG11. Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES |
Rabbit Polyclonal Anti-MGAT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD |
Goat Anti-DPM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence RELEVRSPRQNKYS-C, from the N Terminus of the protein sequence according to NP_003850.1. |
Rabbit polyclonal Anti-ALG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALG1 antibody is: synthetic peptide directed towards the C-terminal region of Human ALG1. Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD |
Rabbit Polyclonal Anti-ALG10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM |
Rabbit Polyclonal Anti-ALG10B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG10B antibody is: synthetic peptide directed towards the N-terminal region of Human ALG10B. Synthetic peptide located within the following region: SVGNFYLLYLLFHKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTE |
Rabbit Polyclonal Anti-ALG10B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG10B antibody is: synthetic peptide directed towards the middle region of Human ALG10B. Synthetic peptide located within the following region: GFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFA |
Rabbit Polyclonal Anti-ALG11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the middle region of human ALG11. Synthetic peptide located within the following region: LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA |
Rabbit Polyclonal Anti-MGAT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF |
Rabbit Polyclonal Anti-B4GALT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH |
Rabbit Polyclonal Anti-B4GALT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD |
Rabbit Polyclonal Anti-B4GALT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR |
Rabbit Polyclonal Anti-B4GALT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the N terminal of human B4GALT3. Synthetic peptide located within the following region: PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCE |
Rabbit Polyclonal Anti-B4GALT3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-B4GALT3 antibody: synthetic peptide directed towards the middle region of human B4GALT3. Synthetic peptide located within the following region: MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN |
Rabbit Polyclonal Anti-DPAGT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DPAGT1 antibody is: synthetic peptide directed towards the C-terminal region of Human DPAGT1. Synthetic peptide located within the following region: TKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLG |
Rabbit Polyclonal Anti-DOLPP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1. Synthetic peptide located within the following region: AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLI |
Rabbit Polyclonal Anti-DDOST Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDOST antibody: synthetic peptide directed towards the N terminal of human DDOST. Synthetic peptide located within the following region: SPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFD |
Rabbit Polyclonal Anti-GCS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GCS1 antibody: synthetic peptide directed towards the N terminal of human GCS1. Synthetic peptide located within the following region: GPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQ |
Rabbit Polyclonal Anti-MAN1A2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAN1A2 antibody: synthetic peptide directed towards the middle region of human MAN1A2. Synthetic peptide located within the following region: FALGADGSRADKAGHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVE |
Rabbit Polyclonal Anti-ALG6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: YEAQRHWQEITFNLPVKQWYFNSSDNNLQYWGLDYPPLTAYHSLLCAYVA |
Rabbit Polyclonal Anti-ALG6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALG6 antibody: synthetic peptide directed towards the N terminal of human ALG6. Synthetic peptide located within the following region: PLTAYHSLLCAYVAKFINPDWIALHTSRGYESQAHKLFMRTTVLIADLLI |
Rabbit Polyclonal Anti-RFT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV |
Mouse monoclonal Anti-CDw75 Clone ZB55
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6F2 (formerly 6F2)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI3E1 (formerly 3E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI6A9 (formerly 6A9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI1G5 (formerly 1G5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPN1 mouse monoclonal antibody, clone OTI2G9 (formerly 2G9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |