Antibodies

View as table Download

Rabbit anti-DLD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DLD

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Rabbit anti-HSD17B10 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSD17B10

Rabbit anti-HADH Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADH

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Rabbit anti-PDHA1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDHA1

Rabbit anti-HADHA Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HADHA

Rabbit anti-ABAT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABAT

Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Rabbit Polyclonal Anti-AUH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AUH antibody: synthetic peptide directed towards the C terminal of human AUH. Synthetic peptide located within the following region: IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Goat Polyclonal Anti-ACAT1 (aa257-269) Antibody

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 (aa257-269) Antibody: Peptide with sequence C-KRVDFSKVPKLKT, from the internal region of the protein sequence according to NP_000010.1.

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the N terminal of human PDHA1. Synthetic peptide located within the following region: MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the N terminal of human OXCT1. Synthetic peptide located within the following region: TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Rabbit Polyclonal Anti-OXCT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT2 antibody: synthetic peptide directed towards the middle region of human OXCT2. Synthetic peptide located within the following region: GIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADLINAGKQTVTV

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-IARS2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IARS2.

Rabbit anti-ACADM Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACADM

Rabbit anti-PCCB Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCCB

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit polyclonal anti-PDHA1 antibody

Applications IHC, WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDHA1.

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Rabbit polyclonal anti-EHHADH antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EHHADH.

Rabbit polyclonal BCKDHB Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This BCKDHB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 41-70 amino acids from the N-terminal region of human BCKDHB.

Rabbit polyclonal ERAB antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERAB.

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Rabbit Polyclonal Anti-BCKDHB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BCKDHB antibody is: synthetic peptide directed towards the N-terminal region of Human BCKDHB. Synthetic peptide located within the following region: GFLHPAATVEDAAQRRQVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDN

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Rabbit Polyclonal Anti-HMGCL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the C terminal of human HMGCL. Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

Rabbit Polyclonal Anti-HADHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HADHB antibody: synthetic peptide directed towards the C terminal of human HADHB. Synthetic peptide located within the following region: LLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAE

Rabbit Polyclonal Anti-PDHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHA1 antibody: synthetic peptide directed towards the C terminal of human PDHA1.

Rabbit Polyclonal Anti-PDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Rabbit Polyclonal Anti-ERAB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ERAB Antibody: Peptide sequence around aa.253~257(L-D-G-A-I)derived from Human ERAB.

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Rabbit Polyclonal antibody to BCAT2 (branched chain aminotransferase 2, mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of BCAT2 (Uniprot ID#O15382)

Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440)

Rabbit polyclonal antibody to HADHB (hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 43 of HADHB (Uniprot ID#P55084)

Rabbit Polyclonal antibody to LARS2 (leucyl-tRNA synthetase 2, mitochondrial)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 181 and 458 of LARS2 (Uniprot ID#Q15031)