Antibodies

View as table Download

Rabbit anti-AR Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AR

Rabbit Polyclonal RARA Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein.

Rabbit Polyclonal Anti-NR4A2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR4A2

Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P).

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: QDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQG

Rabbit Polyclonal PPARG Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein.

Rabbit polyclonal GR (Ab-211) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W).

Rabbit anti-NR0B1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NR0B1

Rabbit Polyclonal Anti-RORB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORB antibody: synthetic peptide directed towards the C terminal of human RORB. Synthetic peptide located within the following region: KNHLDDETLAKLIAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYK

Rabbit polyclonal antibody to RARRES3 (retinoic acid receptor responder (tazarotene induced) 3)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 69 and 164 of RARRES3 (Uniprot ID#Q9UL19)

Rabbit polyclonal anti-NR1I2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR1I2.

Rabbit polyclonal anti-NR4A3 antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NR4A3.

PPARG Rabbit Polyclonal Antibody

Applications ICC/IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human PPARG

Rabbit anti-NR1I3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR1I3

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Polyclonal Anti-RARRES3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human RARRES3

Rabbit anti-RARA Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RARA

Rabbit Polyclonal Anti-NR2C2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2C2 antibody: synthetic peptide directed towards the C terminal of human NR2C2. Synthetic peptide located within the following region: AQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCNS

Rabbit polyclonal anti-NR2F6 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human NR2F6.

Rabbit polyclonal Androgen Receptor (Ab-650) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T).

Rabbit Polyclonal ESRRB Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen ESRRB antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human ESRRB.

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Rabbit Polyclonal Vitamin D Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Vitamin D Receptor

Rabbit Polyclonal antibody to Retinoic Acid Receptor gamma (retinoic acid receptor, gamma)

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 119 and 454 of Retinoic Acid Receptor gamma

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.

Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2).

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit anti-PPARD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPARD

Rabbit Polyclonal Anti-NR1H2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1H2 antibody: synthetic peptide directed towards the N terminal of human NR1H2. Synthetic peptide located within the following region: GNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPD

Rabbit Polyclonal Anti-RARB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RARB

PXR (NR1I2) (Center) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 100-127 aa selected from the Center region of human NR1I2

HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1)

Aryl hydrocarbon Receptor (AHR) (N-term) rabbit polyclonal antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic AhR peptide - KLH conjugated

Rabbit Polyclonal antibody to COUP TF1 (nuclear receptor subfamily 2, group F, member 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of COUP TF1 (Uniprot ID#P10589)

Rabbit polyclonal AhR (Ab-36) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).

RORB / ROR Beta Rabbit Polyclonal (Hinge Domain) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat, Sheep
Immunogen RORB / ROR Beta antibody was raised against synthetic 18 amino acid peptide from hinge domain of human ROR Beta. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Sheep, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Platypus, Lizard (100%); Elephant, Xenopus (94%); Zebrafish (83%).

Anti-NR1I2 Goat Polyclonal Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen NR1I2 / PXR / PAR antibody was raised against synthetic peptide EQFAITLKSYIECNR from an internal region of human NR1I2 / PXR (NP_003880.3; NP_071285.1; NP_148934.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Horse, Pig (87%); Panda, Dog, Rabbit (80%).

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Rabbit Polyclonal AhR (Ser36) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human AhR around the phosphorylation site of Serine 36
Modifications Phospho-specific

Rabbit anti-PTGES3 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PTGES3

Rabbit Polyclonal Anti-NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the C terminal of human NR1I2. Synthetic peptide located within the following region: PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGI

LXR beta (NR1H2) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from (N-term) of human NR1H2

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.

Goat Anti-PXR / NR1I2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence EQFAITLKSYIECNR, from the internal region of the protein sequence according to NP_003880.3; NP_071285.1; NP_148934.1.

Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843)

Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L).

Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L).
Modifications Phospho-specific

Rabbit polyclonal PPAR a (Ab-21) antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PPAR a around the phosphorylation site of serine 21 (L-E-SP-P-L).

Rabbit polyclonal Retinoic Acid Receptor beta antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoic Acid Receptor β.

Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R).
Modifications Phospho-specific