Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Goat Polyclonal Anti-PLA2G2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLA2G2A Antibody: Peptide with sequence C-SYKFSNSGSRIT, from the internal region of the protein sequence according to NP_000291.1. |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGPAT6 |
USD 345.00
In Stock
Rabbit polyclonal anti-PA2G6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PA2G6. |
Rabbit polyclonal PLA2G7 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLA2G7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the Central region of human PLA2G7. |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
Rabbit polyclonal PLD2 (Tyr169) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD2 around the phosphorylation site of tyrosine 169 (E-N-YP-L-N). |
| Modifications | Phospho-specific |
Anti-PLA2G2A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid) |
Rabbit Polyclonal c-PLA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 |
Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV |
Rabbit Polyclonal Anti-PLA2G5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal c-PLA2 (Ser505) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-PLA2 around the phosphorylation site of Serine 505 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal Anti-PLA2G4E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G4E antibody: synthetic peptide directed towards the c terminal of human PLA2G4E. Synthetic peptide located within the following region: TFFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAT |
Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1) |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-PLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the N terminal of human PLD2. Synthetic peptide located within the following region: MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQ |
Rabbit Polyclonal Anti-AGPAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA |
Rabbit Polyclonal Anti-AGPAT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM |
Goat Polyclonal Antibody against PLA2G1B
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1. |
Rabbit anti-PAFAH1B3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human PAF Acetylhydrolase. |
Rabbit polyclonal PLD1 (Thr147) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PLD1 around the phosphorylation site of threonine 147. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-AGPAT3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT3. |
Rabbit polyclonal anti-AGPAT4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT4. |
Rabbit polyclonal anti-PLA2G4E antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit Polyclonal Anti-PLD2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLD2 Antibody: synthetic peptide directed towards the middle region of human PLD2. Synthetic peptide located within the following region: DLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLIT |
Rabbit Polyclonal Anti-PLA2G12B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL |
Rabbit polyclonal Anti-PAFAH1B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAFAH1B1 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B1. Synthetic peptide located within the following region: KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF |
Rabbit Polyclonal Anti-ENPP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENPP2 Antibody: synthetic peptide directed towards the N terminal of human ENPP2. Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA |
Rabbit Polyclonal Anti-AGPAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AGPAT2 Antibody: synthetic peptide directed towards the C terminal of human AGPAT2. Synthetic peptide located within the following region: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA |
Rabbit Polyclonal Anti-ENPP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ENPP6 antibody: synthetic peptide directed towards the middle region of human ENPP6. Synthetic peptide located within the following region: ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS |
Rabbit Polyclonal Anti-PLA2G3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT6 antibody: synthetic peptide directed towards the middle region of human AGPAT6. Synthetic peptide located within the following region: MSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILA |
Anti-AGPS Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human alkylglycerone phosphate synthase |
Anti-AGPAT4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4 |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Anti-AGPAT2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2 |
Anti-PAFAH1B1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human platelet-activating factor acetylhydrolase 1b, regulatory subunit 1 (45kDa) |
Active filters
Reactivities
- Human
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Ether lipid metabolism
Filter by
Category
Target Symbol
- PAFAH1B1 (5)
- PLPP1 (5)
- PLD2 (4)
- AGPAT4 (3)
- GPAT4 (3)
- PLA2G3 (3)
- PLA2G4A (3)
- AGPAT2 (2)
- AGPAT3 (2)
- AGPS (2)
- ENPP6 (2)
- PLA2G2A (2)
- PLA2G4E (2)
- PLA2G5 (2)
- PLA2G6 (2)
- PLPP2 (2)
- ENPP2 (1)
- LCLAT1 (1)
- PAFAH1B2 (1)
- PAFAH1B3 (1)
- PAFAH2 (1)
- PLA2G12A (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2E (1)
- PLA2G7 (1)
- PLD1 (1)