Antibodies

View as table Download

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit anti-PGF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PGF

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit polyclonal HIF1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A.

PI 3 Kinase p85 alpha (PIK3R1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 470-510 of Human PI3K p85α.

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Rabbit Polyclonal HIF1A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HIF1A

Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

STK11 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human STK11

Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

Rabbit anti-EIF4B Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EIF4B

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli.

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607
Modifications Phospho-specific

PRKAA1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKAA1

Rabbit Polyclonal RPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A portion of amino acids 900-950 of human Raptor was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-EIF4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the C terminal of human EIF4B. Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

LKB1 (STK11) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

Rabbit Polyclonal Antibody against BRAF (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF.

Rabbit anti-MTOR polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S).

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit anti-EIF4E Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EIF4E

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences.

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1.

Rabbit Polyclonal Antibody against AKT2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2.

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit Anti-Ribosomal S6 kinase 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH

Rabbit polyclonal anti-LKB1 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human LKB1.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IGF-I

Biotinylated Anti-Human PlGF-1 Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human PlGF-1

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AKT1 (C-term) rabbit polyclonal antibody, Serum

Applications ELISA, IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Immunogen Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide.

STK11 Antibody (N-term I29) Rabbit Polyclonal Antibody (Pab)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This STK11 (LKB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-44 amino acids from the N-terminal region of human STK11 (LKB1).

Rabbit Polyclonal Antibody against FRAP1 (S2481)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1).

Rabbit Polyclonal Rheb Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rheb antibody was raised against a 15 amino acid peptide from the middle region of human Rheb.

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).

LKB1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen STK11 / LKB1 antibody was raised against synthetic peptide from human STK11 / LKB1.

Rabbit polyclonal APG1 (ULK1) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1).

Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308
Modifications Phospho-specific

Rabbit Polyclonal p70 S6 Kinase (Thr389/412) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p70 S6 Kinase around the phosphorylation site of Threonine 389/412
Modifications Phospho-specific