Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Mouse Monoclonal anti-TIMP-2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Chicken, Zebrafish |
| Conjugation | Unconjugated |
Mouse monoclonal anti-NRAS antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 424.00
5 Days
Rabbit Polyclonal Caspase-10/FLICE2 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to N-terminus of Human Caspase 10 |
Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 30-80 of human NAMPT/Visfatin was used as the immunogen. |
Rabbit Polyclonal MEK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen. |
Rabbit Polyclonal MTSS1 Antibody
| Applications | WB |
| Reactivities | Canine, Chicken, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 150-200 of human MTSS1 protein was used as the immunogen. |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the N terminal of human WASF3. Synthetic peptide located within the following region: NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK |
Rabbit Polyclonal Anti-WASF3 Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Turkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS |
Rabbit Polyclonal Anti-GRM8 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GRM8 / MGLUR8 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human GRM8 / MGLUR8. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Baboon, Monkey, Galago, Marmoset, Mouse, Rat, Shrew, Bat, Horse, Armadillo (100%); Opossum, Chicken (95%); Platypus, Xenopus (89%); Stickleback (84%). |
Rabbit Polyclonal Anti-GPR124 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR124 / TEM5 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GPR124. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Hamster, Turkey, Chicken, Xenopus (94%); Monkey, Bovine, Platypus, Lizard (82%). |
Rabbit Polyclonal Anti-CXCR4 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR4. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Tamarin, Mouse, Rat, Bat, Bovine, Dog, Cat, Hamster, Panda, Rabbit, Horse, Pig, Opossum, Lizard (100%); Elephant, Turkey, Chicken (94%). |
Rabbit Polyclonal Anti-GPRC5B Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RAIG2 / GPRC5B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPRC5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bovine, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Xenopus, Pufferfish, Zebrafish, Stickleback (94%). |
Rabbit Polyclonal Anti-ESRRG Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 14 amino acid peptide from N-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit (100%); Opossum, Turkey, Chicken, Platypus, Lizard, Xenopus (93%); Zebrafish (86%). |
Rabbit Polyclonal Anti-TAOK1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TAOK1 / TAO1 antibody was raised against synthetic 15 amino acid peptide from internal region of human TAOK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus (93%). |
Rabbit Polyclonal Anti-EPHB2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | EPHB2 / EPH Receptor B2 antibody was raised against synthetic 15 amino acid peptide from internal region of human EPHB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Panda, Rabbit, Opossum, Zebrafish (100%); Hamster, Elephant, Bovine, Pig, Turkey, Chicken, Pufferfish (93%); Xenopus, Seabass (87%); Stickleback (80%). |
Rabbit Polyclonal Anti-PDE9A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDE9A antibody was raised against synthetic 17 amino acid peptide from internal region of human PDE9A. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Dog (100%); Gorilla, Mouse, Bat, Bovine, Panda, Pig, Turkey, Chicken (94%); Rat (88%); Elephant, Platypus, Lizard (82%). |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Rabbit Polyclonal Anti-LINGO1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LINGO1 antibody was raised against synthetic 17 amino acid peptide from internal region of human LINGO1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Stickleback, Zebrafish (100%); Bat, Opossum, Turkey, Chicken, Pufferfish (94%); Xenopus (82%). |
Rabbit Polyclonal Anti-WNT1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | WNT1 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Chicken (94%); Lizard (88%); Zebrafish (81%). |
Rabbit Polyclonal Anti-LOXL2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LOXL2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human LOXL2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Horse, Rabbit (100%); Mouse, Rat, Opossum, Turkey, Chicken, Platypus (93%); Xenopus, Pufferfish, Zebrafish, Stickleback (87%). |
Rabbit Polyclonal Anti-ERP44 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ERP44 antibody was raised against synthetic 19 amino acid peptide from internal region of human ERP44 / TXNDC4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Dog, Bovine, Hamster, Panda, Rabbit, Horse, Opossum, Turkey, Chicken, Platypus (95%); Mouse, Pig, Lizard (89%); Elephant (84%). |
Mouse monoclonal Anti-CD3 Clone PC3/188A
| Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu1 Clone CD5/54/F6
| Reactivities | Bovine, Chicken, Guinea Pig, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD79a Clone HM57
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD17a Clone HM47
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Opossum, Primate, Rabbit, Rat, Pig, Horse |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Cx32 Clone Connexin32
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Caspase 2 Polyclonal Antibody
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Rho Kinase/ROCKII (pT396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- with a single phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, ChiChickenen |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins |
Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti p56-LCK (LSK) (pY505) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from Carboxyl-terminus of p56lck protein with a phosphorylation site at Tyr 505 from human, rat, bovine and dog origin. |
Rabbit anti Rho Kinase/ROCKII (Paired T396) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -VETFP- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide (19mer) derived from 250-350 amino acids of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (pT249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- with a single phosphorylation site Thr249 of human Rho Kinase/RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti Rho Kinase/ROCKII (Paired T249) Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope -CDTAV- without a phosphorylation site Thr396 of human RockII protein. This sequence is identical among human, mouse, rat, chicken, dog and bovine. |
Rabbit anti BCL-w Polyclonal Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human BCL-W protein. This sequence is identical among human, rat and mouse origins. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Rabbit Polyclonal Anti-Vinculin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Vinculin antibody was raised against a 23 amino acid peptide near the amino terminus of human Vinculin. |
Mouse Monoclonal Anti-Vinculin Antibody [8B5]
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
