Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-AHCY Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-BHMT Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Rabbit Polyclonal Anti-LDHB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD |
Rabbit Polyclonal Anti-BHMT Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit Polyclonal DNMT3B Antibody
Applications | ELISA, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein. |
Rabbit Polyclonal Anti-DNMT3A Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE |
Goat Polyclonal Antibody against GOT1 (Internal region)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Anti-GOT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MTAP Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MTAP |
Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Rabbit anti-CBS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBS |
Rabbit Polyclonal Anti-MAT1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE |
Rabbit Polyclonal DNMT1 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT1 antibody: mouse DNMT1 (DNA (cytosine-5)-methyltransferase 1), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the C-terminal part of the protein. |
Rabbit Polyclonal DNMT3A Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 44-58. |
Rabbit Polyclonal DNMT3A Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 92-106. |
Rabbit Polyclonal DNMT3A Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3A antibody: human DNMT3A, (DNA methyltransferase 3A), using a KLH-conjugated synthetic peptide corresponding to amino acids 107-121. |
Rabbit Polyclonal DNMT3B Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Rabbit Polyclonal DNMT2 Antibody
Applications | ELISA, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT2 antibody: mouse Dnmt2 (DNA methyltransferase 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein (1). |
Rabbit polyclonal anti-DNMT3B antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B. |
Rabbit polyclonal GOT2 Antibody (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit anti-BHMT Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BHMT |
DNMT3A Rabbit Polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DNMT3A |
DNMT3B Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human DNMT3B |
Rabbit polyclonal Anti-DNMT3B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DNMT3B antibody: synthetic peptide directed towards the middle region of human DNMT3B. Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
Rabbit Polyclonal Anti-MAT1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH |
Rabbit Polyclonal Anti-MPST Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST. Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT |
Anti-AMD1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1 |
Anti-DNMT1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1 |
Rabbit anti-LDHA Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LDHA |
Rabbit Polyclonal Anti-ENOPH1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the middle region of human ENOPH1. Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS |
Rabbit Polyclonal Anti-ENOPH1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the N terminal of human ENOPH1. Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD |
Rabbit Polyclonal Anti-APIP Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APIP antibody: synthetic peptide directed towards the middle region of human APIP. Synthetic peptide located within the following region: GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV |
Rabbit Polyclonal Anti-APIP Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-APIP antibody is: synthetic peptide directed towards the N-terminal region of Human APIP. Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP |
Rabbit Polyclonal Anti-SDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDS antibody: synthetic peptide directed towards the N terminal of human SDS. Synthetic peptide located within the following region: AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA |
Rabbit Polyclonal Anti-SDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDS antibody: synthetic peptide directed towards the middle region of human SDS. Synthetic peptide located within the following region: KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI |
Rabbit Polyclonal Anti-MTR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTR antibody: synthetic peptide directed towards the C terminal of human MTR. Synthetic peptide located within the following region: GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
Rabbit Polyclonal Anti-TRDMT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRDMT1 antibody: synthetic peptide directed towards the N terminal of human TRDMT1. Synthetic peptide located within the following region: MILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKYILLENV |
Rabbit Polyclonal Anti-CDO1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CDO1 antibody was raised against a 19 amino acid peptide near the amino terminus of human CDO1. |
Rabbit Polyclonal Antibody against DNMT3a
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This antibody was raised against amino acids 10-118 of the human DNMT3a protein. |
Goat Polyclonal Antibody against LDHC (aa 221 - 233)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DSDKEHWKNVHKQ, from the internal region of the protein sequence according to NP_002292.1; NP_059144.1. |
Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088) |
Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088) |
Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2) |
Rabbit polyclonal anti-IL4I1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
LDHB Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Internal region (near C terminus) (NARGLTSVINQKLK) |
Rabbit Polyclonal Anti-CTH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK |
Rabbit Polyclonal TAT Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Special Offer: Get a 15% discount on this product. Use code: "KO15".