Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-Atf4 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Active filters
Conjugates
- Unconjugated
Pathways
- GnRH signaling pathway
Filter by
Target Symbol
- MAP2K1 (143)
- EGFR (122)
- JUN (122)
- MAP2K3 (95)
- MAPK13 (58)
- MAPK1 (46)
- FSHB (39)
- MAPK7 (35)
- GNAS (34)
- KRAS (34)
- MAPK8 (29)
- HRAS (28)
- MAPK14 (28)
- MAP2K4 (26)
- MAP2K2 (23)
- ATF4 (22)
- RAF1 (21)
- CAMK2B (19)
- MAPK9 (19)
- MMP2 (18)
- PRKCA (18)
- PRKCD (16)
- SRC (16)
- ELK1 (15)
- HBEGF (15)
- MAPK3 (15)
- MAPK10 (13)
- NRAS (13)
- PLA2G3 (12)
- PRKCB (11)
- MAP2K6 (10)
- PTK2B (9)
- CAMK2A (8)
- PLA2G6 (8)
- CGA (7)
- GRB2 (7)
- MAPK12 (7)
- PRKACA (7)
- GNRHR (6)
- MMP14 (6)
- CACNA1C (5)
- CDC42 (5)
- MAPK11 (5)
- PLA2G2A (5)
- CAMK2G (4)
- GNA11 (4)
- GNRH1 (4)
- MAP2K7 (4)
- MAP3K1 (4)
- PLA2G4A (4)
- PLD2 (4)
- PRKACB (4)
- ADCY1 (3)
- ADCY4 (3)
- ADCY5 (3)
- ADCY6 (3)
- CAMK2D (3)
- LHB (3)
- MAP3K4 (3)
- PRKACG (3)
- PRKX (3)
- SOS2 (3)
- ADCY2 (2)
- ADCY3 (2)
- ADCY8 (2)
- CACNA1D (2)
- CALM2 (2)
- GNAQ (2)
- MAP3K2 (2)
- MAP3K3 (2)
- PLA2G4E (2)
- PLA2G5 (2)
- PLCB1 (2)
- PLCB2 (2)
- PLCB3 (2)
- ADCY7 (1)
- ADCY9 (1)
- CACNA1S (1)
- CALM1 (1)
- CALM3 (1)
- CALML3 (1)
- CALML5 (1)
- CALML6 (1)
- GNRH2 (1)
- ITPR1 (1)
- ITPR2 (1)
- ITPR3 (1)
- PLA2G12A (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2E (1)
- PLD1 (1)
- SOS1 (1)
Reactivities
- Human (1293)
- Mouse (1112)
- Rat (1045)
- Dog (280)
- Monkey (223)
- Bovine (20)
- Pig (13)
- Chicken (12)
- Xenopus (7)
- Rabbit (5)
- Canine (4)
- Cow (4)
- Drosophila (3)
- Hamster (3)
- Rhesus Monkey (3)
- Canis (2)
- Horse (2)
- Porcine (2)
- C. elegans (1)
- Feline (1)
- Fish (1)
- Gibbon (1)
- Gorilla (1)
- Guinea Pig (1)
- Mammalian (1)
- Primate (1)
- Sheep (1)
- Tobacco hornworm (1)
- X. tropicalis (1)
- Zebrafish (1)
Applications
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1258)
- Protein Kinase (831)
- ES Cell Differentiation/IPS (348)
- Transcription Factors (254)
- Secreted Protein (243)
- Transmembrane (186)
- Stem cell relevant signaling - JAK/STAT signaling pathway (138)
- Adult stem cells (122)
- Cancer stem cells (122)
- Protease (24)
- Ion Channels: Calcium (8)
- GPCR (6)