Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-POLR2C antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This POLR2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 200-228 amino acids from the C-terminal region of human POLR2C. |
Rabbit Polyclonal Anti-NDUFV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG |
Goat Polyclonal Anti-TNNI3 (aa117-127) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNNI3 (aa117-127) Antibody: Peptide with sequence C-KVTKNITEIAD, from the internal region of the protein sequence according to NP_000354.4. |
Goat Polyclonal Anti-TBP /Transcription factor IID (aa39-50) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TBP /Transcription factor IID (aa39-50) Antibody: Peptide with sequence C-TPQPIQNTNSLS, from the internal region of the protein sequence according to NP_003185.1; NP_001165556.1. |
Glutathione Peroxidase 1 (GPX1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-193aa) of human Glutathione peroxidase 1 / GPX1. |
Rabbit polyclonal antibody to dynactin 1 (dynactin 1 (p150, glued homolog, Drosophila))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1216 and 1278 of DCTN1 (Uniprot ID#Q14203) |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit anti-TGM2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TGM2 |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Rabbit anti-SLC25A4 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC25A4 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF antibody is: synthetic peptide directed towards the N-terminal region of Human BDNF. Synthetic peptide located within the following region: EELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYL |
Rabbit Polyclonal Anti-PSD95 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSD95 Antibody: A synthesized peptide derived from human PSD95 |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
USD 415.00
In Stock
Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912) |
Mouse Monoclonal anti-DLG4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-ATP5A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5A1. |
USD 450.00
In Stock
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NMDAR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit anti-DCTN1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DCTN1 |
Rabbit anti-POLR2C Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human POLR2C |
Rabbit Polyclonal Anti-CREB-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB-BP Antibody: A synthesized peptide derived from human CREB-BP |
Rabbit Polyclonal Anti-BBC3(PUMA) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BBC3(PUMA) Antibody: A synthesized peptide derived from human BBC3(PUMA) |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit Polyclonal Anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 440.00
2 Weeks
Active filters
Families
- Druggable Genome
Pathways
- Huntington's disease
Filter by
Target Symbol
- TP53 (255)
- ATP5F1B (53)
- CASP3 (49)
- HDAC1 (49)
- AP2M1 (45)
- BAX (35)
- SDHB (33)
- CREB1 (32)
- TGM2 (30)
- CASP9 (26)
- HDAC2 (26)
- IFT57 (22)
- UQCRC1 (22)
- CASP8 (19)
- GRIN1 (19)
- GRIN2B (18)
- CYCS (17)
- BBC3 (16)
- PPARG (15)
- SOD2 (15)
- SOD1 (14)
- APAF1 (12)
- BDNF (12)
- DLG4 (12)
- EP300 (12)
- SP1 (12)
- TBP (10)
- CREBBP (7)
- GRM5 (7)
- PPARGC1A (7)
- VDAC2 (7)
- AP2B1 (6)
- DCTN1 (6)
- NDUFV2 (6)
- TFAM (6)
- UCP1 (5)
- ATP5F1A (4)
- GPX1 (4)
- HTT (4)
- NDUFS4 (4)
- PLCB3 (4)
- SDHA (4)
- SLC25A4 (4)
- CYC1 (3)
- NDUFV1 (3)
- PLCB1 (3)
- POLR2C (3)
- SLC25A31 (3)
- SLC25A6 (3)
- TRPC1 (3)
- VDAC3 (3)
- CASPASE 9 (2)
- GNAQ (2)
- HIP1 (2)
- LCMT2 (2)
- PLCB2 (2)
- SIN3A (2)
- UQCRC2 (2)
- COX7A2L (1)
- DNAI1 (1)
- ITPR1 (1)
- SDHC (1)
Reactivities
- Human (886)
- Mouse (499)
- Rat (471)
- Monkey (149)
- Dog (81)
- Pig (16)
- Bovine (14)
- Cow (13)
- Canine (9)
- Xenopus (7)
- Chicken (6)
- Gerbil (5)
- Rabbit (5)
- Primate (4)
- Chimpanzee (3)
- Hamster (3)
- Zebrafish (3)
- Macaque (2)
- Sheep (2)
- Coral (1)
- Drosophila (1)
- Equine (1)
- Feline (1)
- Guinea Pig (1)
- Mammalian (1)
- Rhesus Monkey (1)
- X. tropicalis (1)
- Yeast (1)