Germany
Japan
United Kingdom
China
Antibodies
Download
USD 270.00
2 Weeks
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-K5, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-P8, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD130 (IL6ST) mouse monoclonal antibody, clone B-S12, Azide Free
| Applications | FC, FN, IP, WB |
| Reactivities | Human |
USD 300.00
2 Weeks
IL13 receptor alpha 2 (IL13RA2) mouse monoclonal antibody, clone B-D13, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
IL10 mouse monoclonal antibody, clone B-S10, Azide Free
| Applications | ELISA, FN |
| Reactivities | Human |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T). |
| Modifications | Phospho-specific |
IL-21 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor . |
Rabbit polyclonal anti-G-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 195 of human G-CSF |
Rabbit polyclonal anti-GM-CSF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human GM-CSF protein. |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT2 |
Rabbit anti-IL-6R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL-6R |
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Anti-Human IL-22 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-22 |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit anti-IFNAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR1 |
Rabbit anti-GRB2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRB2 |
Rabbit Polyclonal Anti-EPO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPO antibody: synthetic peptide directed towards the middle region of human EPO. Synthetic peptide located within the following region: KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD |
Rabbit Polyclonal Anti-IL28RA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL28RA antibody: synthetic peptide directed towards the N terminal of human IL28RA. Synthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF |
Rabbit Polyclonal Anti-CREB-BP Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB-BP Antibody: A synthesized peptide derived from human CREB-BP |
Active filters
Families
- Druggable Genome
Pathways
- Jak-STAT signaling pathway
Filter by
Target Symbol
- IL6 (144)
- AKT1 (127)
- STAT5A (76)
- STAT4 (71)
- PIK3CG (64)
- MYC (61)
- CSF3 (60)
- CSF2 (59)
- SOCS3 (59)
- STAT1 (52)
- PRL (49)
- PIK3R5 (47)
- IL20 (46)
- IFNG (45)
- AKT2 (44)
- CCND2 (42)
- CSH1 (40)
- CCND1 (37)
- CSF2RB (37)
- IL2 (36)
- JAK2 (35)
- PIK3CD (35)
- PTPN11 (35)
- STAT3 (33)
- IL10RA (31)
- IL12A (30)
- IL24 (30)
- BCL2L1 (29)
- IL2RA (29)
- IL2RB (28)
- IFNLR1 (27)
- CSF2RA (26)
- PIK3CA (25)
- IL20RA (23)
- IL4 (23)
- IL12B (21)
- IL10 (20)
- IL15RA (20)
- AKT3 (19)
- EPOR (18)
- STAT5B (18)
- STAT6 (17)
- CBLC (16)
- IL15 (16)
- IL3 (15)
- IL23R (14)
- IL6ST (14)
- IL7 (14)
- JAK3 (14)
- PIK3R1 (14)
- SOCS1 (14)
- IL6R (13)
- LEP (13)
- EP300 (12)
- GH1 (12)
- PTPN6 (12)
- EPO (11)
- GRB2 (11)
- IFNL1 (11)
- IL13 (11)
- PIM1 (11)
- GH2 (10)
- IFNB1 (10)
- IL9 (10)
- JAK1 (10)
- STAT2 (10)
- CBL (9)
- IFNGR2 (9)
- IL12RB1 (9)
- IL23A (9)
- PIAS1 (9)
- CCND3 (8)
- CRLF2 (8)
- IL13RA2 (8)
- IL19 (8)
- IL21 (8)
- IL22 (8)
- IL5 (8)
- OSM (8)
- SOCS4 (8)
- TSLP (8)
- TYK2 (8)
- CNTF (7)
- CREBBP (7)
- IFNA2 (7)
- IL11 (7)
- IFNA6 (6)
- IFNAR1 (6)
- IFNL2 (6)
- IL11RA (6)
- IL22RA1 (6)
- TPO (6)
- CSF3R (5)
- IFNL3 (5)
- IL13RA1 (5)
- IL4R (5)
- LIF (5)
- PRLR (5)
- SOCS2 (5)
- SOCS5 (5)