Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Active filters
Families
- Druggable Genome
Pathways
- Neurotrophin signaling pathway
Filter by
Target Symbol
- TP53 (255)
- MAP2K1 (237)
- JUN (183)
- AKT1 (127)
- BRAF (100)
- BCL2 (99)
- MAPK13 (99)
- MAPK1 (74)
- PIK3CG (64)
- KRAS (58)
- MAPK7 (57)
- IRS1 (56)
- MAPK8 (55)
- NGFR (55)
- RELA (54)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- RPS6KA2 (44)
- NFKBIE (42)
- MAPK14 (41)
- TP73 (41)
- NFKB1 (36)
- BAX (35)
- PIK3CD (35)
- PTPN11 (35)
- FOXO3 (34)
- MAP2K2 (34)
- RAF1 (33)
- SHC1 (32)
- MAPK9 (31)
- NFKBIA (30)
- CAMK2B (29)
- IRAK2 (27)
- PIK3CA (25)
- NTF3 (24)
- NTRK3 (24)
- RAPGEF1 (24)
- MAPK3 (23)
- NTRK2 (22)
- ABL1 (21)
- BAD (21)
- GSK3B (20)
- IKBKB (20)
- MAP3K5 (20)
- AKT3 (19)
- MAPK10 (19)
- PRKCD (19)
- NTRK1 (18)
- NRAS (17)
- ARHGDIA (16)
- PLCG1 (15)
- NTF4 (14)
- PIK3R1 (14)
- FASLG (13)
- IRAK1 (13)
- RPS6KA1 (13)
- YWHAB (13)
- BDNF (12)
- CAMK2A (11)
- GRB2 (11)
- RPS6KA5 (11)
- YWHAG (11)
- MAPKAPK2 (10)
- TRAF6 (10)
- IRS2 (9)
- MAPK12 (9)
- NGF (9)
- PLCG2 (9)
- RHOA (9)
- YWHAQ (9)
- CAMK4 (8)
- CRK (8)
- CSK (8)
- GAB1 (8)
- RIPK2 (8)
- SORT1 (8)
- CRKL (7)
- FRS2 (7)
- IRAK3 (7)
- IRAK4 (7)
- MAPK11 (7)
- PDK1 (7)
- PSEN1 (7)
- YWHAE (7)
- RAC1 (6)
- RAP1A (6)
- CAMK2G (5)
- CDC42 (5)
- MAP2K7 (5)
- ARHGDIB (4)
- CALM2 (4)
- MAGED1 (4)
- MAP3K1 (4)
- PIK3CB (4)
- PIK3R3 (4)
- RAP1B (4)
- CALM3 (3)
- CAMK2D (3)
- KIDINS220 (3)
Reactivities
- Human (2737)
- Mouse (2283)
- Rat (2134)
- Monkey (469)
- Dog (423)
- Bovine (29)
- Chicken (21)
- Pig (18)
- Cow (12)
- Xenopus (8)
- Rabbit (7)
- Canine (6)
- Hamster (5)
- Rhesus Monkey (5)
- Canis (4)
- Drosophila (4)
- Primate (3)
- C. elegans (2)
- Guinea Pig (2)
- Sheep (2)
- X. tropicalis (2)
- Zebrafish (2)
- Chimpanzee (1)
- Equine (1)
- Macaque (1)
- Porcine (1)
- Tobacco hornworm (1)
- Yeast (1)