Germany
Japan
United Kingdom
China
Rabbit Polyclonal Caspase 3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 3 |
Antibodies
View as table Download
Rabbit Polyclonal Caspase 3 (Ser150) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 3 around the phosphorylation site of Serine 150 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ERK1/2 (Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p44/42 MAP Kinase (Thr202) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p44/42 MAP Kinase around the phosphorylation site of Threonine 202 |
| Modifications | Phospho-specific |
Rabbit polyclonal p44 MAPK antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p44 MAPK. |
Rabbit Polyclonal GAPDH antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GAPDH |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 150 and 200 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
GAPDH mouse monoclonal antibody, clone H8, Purified
| Applications | ELISA, WB |
| Reactivities | Bacteria, Human, Insect, Mouse, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
ERK1 (MAPK3) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
Rabbit Polyclonal Cleaved-caspase 3 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Mouse anti GAPDH Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Caspase 3 (CASP3) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human Caspase-3 (P10) |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Caspase 3 (CASP3) (29-33) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.29~33 derived from Caspase 3 |
Caspase 3 (CASP3) (29-33) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.29~33 derived from Caspase 3 |
Goat Polyclonal Antibody against ERK1 / MAPK3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence GGEPRRTEGVGP-C, from the N Terminus of the protein sequence according to NP_002737.1. |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit Polyclonal APH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | APH1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human APH1a. |
Chicken Polyclonal GAPDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid peptide from near the amino terminus of human GAPDH. |
Goat Anti-Caspase 3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDVSKEDHSKRS, from the internal region of the protein sequence according to NP_004337.2; NP_116786.1. |
Rabbit Polyclonal Caspase-3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Caspase-3 antibody was raised against a 17 amino acid synthetic peptide near the center of human Caspase-3. |
Rabbit Polyclonal erk1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human ERK1/2. |
USD 450.00
5 Days
Mouse monoclonal anti-CASP3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
| Conjugation | Unconjugated |
| Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus, Yeast |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 200 and 250 of human GAPDH using the numbering given in entry NP_002037.2 (GeneID 2597). |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to a region between residues 300 and the C-terminus (residue 335) of mouse GAPDH using the numbering given in entry NP_001001303.1 (GeneID 407972). |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti ERK1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GAPDH Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Biotin-GAPDH antibody was raised against a synthetic peptide containing 16 amino acids near the carboxy terminus of GAPDH. |
Active filters
Families
- ES Cell Differentiation/IPS
Pathways
- Alzheimer's disease
Filter by
Category
Target Symbol
Reactivities
- Human (129)
- Mouse (104)
- Rat (96)
- Monkey (18)
- Dog (15)
- Rabbit (8)
- Chicken (7)
- Bovine (5)
- Canine (5)
- Drosophila (4)
- Porcine (4)
- Feline (3)
- Pig (3)
- Xenopus (3)
- Yeast (3)
- Zebrafish (3)
- Avian (2)
- Bacteria (2)
- Insect (2)
- Primate (2)
- All Species (1)
- Cow (1)
- Gerbil (1)
- Goat (1)
- Hamster (1)
- Invertebrate (1)
- Protozoa (1)