Germany
Japan
United Kingdom
China
Antibodies
Download
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Anti-Human IL-1 beta Purified (50 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal TACE Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TACE antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human TACE This sequence differs from those of mouse and rat TACE by one amino acid. |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Anti-GAPDH mouse mAb (Loading control)
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Rabbit anti-FADD Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FADD |
Rabbit Polyclonal Anti-SDHB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Phospho-NOS3-S1177 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-NDUFA7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Active filters
Pathways
- Alzheimer's disease
Filter by
Target Symbol
- APP (111)
- MAPT (94)
- MAPK1 (74)
- LPL (61)
- BID (60)
- TNF (60)
- GAPDH (59)
- APOE (58)
- ATP5F1B (53)
- NDUFA7 (51)
- CASP3 (49)
- MME (45)
- NDUFB10 (39)
- COX6A1 (36)
- NAE1 (35)
- SNCA (35)
- NDUFB9 (34)
- SDHB (33)
- HSD17B10 (29)
- CHP1 (28)
- NOS2 (27)
- CASP9 (26)
- NOS3 (25)
- APBB1 (23)
- IL1B (23)
- MAPK3 (23)
- UQCRC1 (22)
- BAD (21)
- NDUFA4L2 (21)
- GSK3B (20)
- CASP8 (19)
- FAS (19)
- GRIN1 (19)
- CDK5 (18)
- GRIN2B (18)
- CASP7 (17)
- CYCS (17)
- NDUFB3 (15)
- NDUFS2 (14)
- PPP3CA (14)
- TNFRSF1A (13)
- APAF1 (12)
- CAPN2 (12)
- COX6C (12)
- COX4I1 (11)
- FADD (11)
- IDE (11)
- ATF6 (10)
- NOS1 (9)
- PPP3CB (9)
- ADAM17 (8)
- ATP2A2 (8)
- GRIN2A (8)
- UQCRFS1 (8)
- ATP5F1C (7)
- ERN1 (7)
- NDUFA5 (7)
- PSEN1 (7)
- ATP5PO (6)
- BACE1 (6)
- BACE2 (6)
- CACNA1C (6)
- CAPN1 (6)
- COX6B2 (6)
- EIF2AK3 (6)
- NDUFA2 (6)
- NDUFS1 (6)
- NDUFV2 (6)
- ADAM10 (5)
- COX6B1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- PSENEN (5)
- ATP2A1 (4)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- CALM2 (4)
- COX5B (4)
- GRIN2C (4)
- LRP1 (4)
- NCSTN (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PLCB3 (4)
- SDHA (4)
- APH1A (3)
- ATP2A3 (3)
- ATP5PB (3)
- ATP5PD (3)
- CALM3 (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
Reactivities
- Human (1666)
- Mouse (1120)
- Rat (1066)
- Monkey (147)
- Dog (136)
- Bovine (27)
- Rabbit (19)
- Pig (17)
- Cow (15)
- Chicken (13)
- Canine (11)
- Chimpanzee (11)
- Xenopus (8)
- Primate (7)
- Rhesus Monkey (6)
- Drosophila (5)
- Feline (4)
- Gerbil (4)
- Porcine (4)
- Zebrafish (4)
- Hamster (3)
- X. tropicalis (3)
- Yeast (3)
- Avian (2)
- Bacteria (2)
- Canis (2)
- Goat (2)
- Insect (2)
- All Species (1)
- Equine (1)
- Eukaryote (1)
- Invertebrate (1)
- Macaque (1)
- Mammalian (1)
- Protozoa (1)
- Sheep (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1331)
- Transmembrane (504)
- Protease (246)
- Secreted Protein (179)
- ES Cell Differentiation/IPS (153)
- Protein Kinase (148)
- Transcription Factors (115)
- Stem cell - Pluripotency (86)
- Adult stem cells (58)
- Ion Channels: Glutamate Receptors (52)
- Phosphatase (28)
- Ion Channels: Calcium (9)
- Ion Channels: Sodium (8)