Germany
Japan
United Kingdom
China
Antibodies
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Mouse Monoclonal TFRC (CD71) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
USD 379.00
In Stock
AFP Capture mouse monoclonal antibody, ELISA validated, clone OTI2E2
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Matched ELISA Pair | TA700014 |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Mouse Anti-Human IL-1 beta Purified (50 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
USD 380.00
In Stock
Plasminogen (PLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Plasminogen isolated and purified from human plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-MGP
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM |
Rabbit Polyclonal Anti-RFX1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human RFX1. The immunogen is located within the last 50 amino acids of RFX1. |
Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Prepro-NPY 68-97 (C-PON). |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Rabbit polyclonal antibody to QSOX1 (quiescin Q6 sulfhydryl oxidase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 231 and 617 of QSOX1 (Uniprot ID#O00391) |
Active filters
Families
- Secreted Protein
Filter by
Target Symbol
- KLK8 (256)
- EGFR (207)
- IL6 (144)
- LIPG (133)
- MSMB (126)
- CD40 (125)
- AFP (116)
- LCN2 (116)
- CFI (112)
- ADIPOQ (111)
- IL1RL1 (109)
- IL17A (108)
- LGALS3 (107)
- VWF (106)
- F13A1 (98)
- CHGA (84)
- FGF21 (75)
- LOX (75)
- FSHB (74)
- ERBB3 (73)
- NPPB (73)
- CD163 (71)
- SYP (71)
- CD8A (68)
- ICOS (68)
- FGFR2 (66)
- MUC1 (64)
- FGG (62)
- HP (62)
- KLK3 (62)
- AGR2 (60)
- CSF3 (60)
- SERPINB3 (60)
- TNF (60)
- CSF2 (59)
- APOE (58)
- MSLN (56)
- TIMP2 (54)
- CRP (53)
- VEGFA (53)
- PMEL (52)
- SERPINA5 (50)
- PRL (49)
- ACE2 (48)
- FCER2 (48)
- GNAS (48)
- SERPINA1 (48)
- ALB (47)
- SYT4 (47)
- WNT3 (47)
- IL1RN (46)
- IL20 (46)
- RAB37 (46)
- CPA1 (45)
- IFNG (45)
- REN (45)
- SERPINB4 (42)
- RNASE11 (41)
- VIP (41)
- TFPI (40)
- TNFRSF18 (40)
- WFDC2 (40)
- AMH (39)
- APOA5 (39)
- SPP1 (39)
- IL1A (38)
- LAMB3 (38)
- TFPI2 (38)
- LGALS3BP (37)
- P3H1 (37)
- CALR (36)
- IL2 (36)
- PROZ (36)
- CST2 (35)
- SERPINB2 (35)
- GRN (34)
- IGFBP1 (34)
- CCN2 (33)
- CPA2 (33)
- PON3 (33)
- POSTN (33)
- ERAP1 (32)
- PON1 (32)
- PTH (32)
- APOL1 (31)
- FGF2 (31)
- FN1 (31)
- IGF1 (31)
- IL12A (30)
- IL24 (30)
- SIL1 (30)
- STX1A (30)
- TFF1 (30)
- CSF1 (29)
- MASP2 (29)
- MSTN (29)
- FCGR3A (28)
- SERPINE2 (28)
- SPINT1 (28)
- CCL2 (27)
Reactivities
- Human (9522)
- Mouse (2880)
- Rat (2392)
- Dog (220)
- Monkey (162)
- Bovine (72)
- Pig (67)
- Cow (39)
- Rabbit (36)
- Chicken (25)
- Horse (22)
- Gorilla (20)
- Hamster (20)
- Primate (20)
- Gibbon (19)
- Bat (18)
- Porcine (14)
- Canine (13)
- Macaque (12)
- Mammalian (11)
- Chimpanzee (7)
- Xenopus (7)
- Guinea Pig (6)
- Rhesus Monkey (5)
- Sheep (5)
- Zebrafish (5)
- Equine (4)
- Orang-Utan (4)
- Opossum (3)
- Feline (2)
- Goat (2)
- Amphibian (1)
- Birds (1)
- Drosophila (1)
- Fish (1)
- Pufferfish (1)
- SimianIVE (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Cytokine-cytokine receptor interaction (2241)
- Pathways in cancer (1282)
- Jak-STAT signaling pathway (910)
- Complement and coagulation cascades (818)
- MAPK signaling pathway (758)
- Hematopoietic cell lineage (711)
- Focal adhesion (671)
- Toll-like receptor signaling pathway (554)
- Regulation of actin cytoskeleton (550)
- Melanoma (441)
- Allograft rejection (414)
- GnRH signaling pathway (414)
- T cell receptor signaling pathway (405)
- Endocytosis (397)
- Prostate cancer (396)
- Graft-versus-host disease (379)
- Pancreatic cancer (368)
- Bladder cancer (367)
- Systemic lupus erythematosus (354)
- ErbB signaling pathway (336)
- NOD-like receptor signaling pathway (333)
- Calcium signaling pathway (328)
- Metabolic pathways (324)
- TGF-beta signaling pathway (322)
- Asthma (311)
- Type I diabetes mellitus (311)
- Autoimmune thyroid disease (296)
- ECM-receptor interaction (289)
- Hypertrophic cardiomyopathy (HCM) (288)
- Epithelial cell signaling in Helicobacter pylori infection (281)
- Primary immunodeficiency (281)
- Cell adhesion molecules (CAMs) (280)
- Prion diseases (267)
- Gap junction (261)
- Chemokine signaling pathway (258)
- Natural killer cell mediated cytotoxicity (257)
- Neuroactive ligand-receptor interaction (246)
- Glioma (244)
- Cytosolic DNA-sensing pathway (243)
- Colorectal cancer (242)
- Hedgehog signaling pathway (238)
- Adipocytokine signaling pathway (231)
- Non-small cell lung cancer (213)
- Melanogenesis (212)
- Adherens junction (207)
- Dorso-ventral axis formation (207)
- Endometrial cancer (207)
- Fc epsilon RI signaling pathway (204)
- PPAR signaling pathway (198)
- Wnt signaling pathway (195)
- Basal cell carcinoma (194)
- Apoptosis (193)
- Type II diabetes mellitus (189)
- RIG-I-like receptor signaling pathway (187)
- Alzheimer's disease (179)
- Dilated cardiomyopathy (176)
- mTOR signaling pathway (169)
- Antigen processing and presentation (162)
- Renal cell carcinoma (161)
- Glycerolipid metabolism (155)
- Viral myocarditis (141)
- Renin-angiotensin system (132)
- Long-term depression (112)
- Small cell lung cancer (107)
- p53 signaling pathway (101)
- Amyotrophic lateral sclerosis (ALS) (85)
- Regulation of autophagy (85)
- VEGF signaling pathway (81)
- Vascular smooth muscle contraction (76)
- Neurotrophin signaling pathway (72)
- Axon guidance (70)
- Oocyte meiosis (49)
- Progesterone-mediated oocyte maturation (49)
- Taste transduction (48)
- Vibrio cholerae infection (48)
- Proteasome (45)
- Fc gamma R-mediated phagocytosis (44)
- Cell cycle (43)
- Chronic myeloid leukemia (35)
- SNARE interactions in vesicular transport (35)
- Arachidonic acid metabolism (33)
- Ether lipid metabolism (31)
- Glycerophospholipid metabolism (28)
- Linoleic acid metabolism (28)
- alpha-Linolenic acid metabolism (28)
- Amino sugar and nucleotide sugar metabolism (25)
- Histidine metabolism (24)
- Maturity onset diabetes of the young (22)
- Starch and sucrose metabolism (22)
- Insulin signaling pathway (18)
- beta-Alanine metabolism (18)
- Leukocyte transendothelial migration (16)
- Huntington's disease (12)
- Purine metabolism (10)
- Pyrimidine metabolism (10)
- Glycosaminoglycan degradation (9)
- Acute myeloid leukemia (8)
- N-Glycan biosynthesis (8)
- Glycosphingolipid biosynthesis - lacto and neolacto series (7)
- Pathogenic Escherichia coli infection (7)
- Tyrosine metabolism (7)
- Arginine and proline metabolism (6)
- Tryptophan metabolism (6)
- Folate biosynthesis (5)
- Glutathione metabolism (5)
- Keratan sulfate biosynthesis (4)
- O-Glycan biosynthesis (4)
- Riboflavin metabolism (4)
- Galactose metabolism (3)
- Nitrogen metabolism (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Lysosome (2)
- Other glycan degradation (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)