Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Goat Polyclonal Anti-Ubiquitin Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human ubiquitin produced in E. coli. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Anti-NR1I2 Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NR1I2 / PXR / PAR antibody was raised against synthetic peptide EQFAITLKSYIECNR from an internal region of human NR1I2 / PXR (NP_003880.3; NP_071285.1; NP_148934.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (93%); Horse, Pig (87%); Panda, Dog, Rabbit (80%). |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal LIM1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 379.00
In Stock
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal Hif-1 alpha hydroxy P564 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region surrounding the P564 of human HIF-1a. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Goat Polyclonal Anti-Rab1b Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli. |
Goat Polyclonal Anti-Rab1b Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Goat Polyclonal Anti-ATXN3 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to 250 aa of human ATXN3 produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
| Applications | E |
| Reactivities | Human, Monkey |
| Conjugation | Biotin |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit polyclonal STAT2 phospho Y690 antibody
| Applications | IHC, WB |
| Reactivities | Human, Chimpanzee, Macaque, Vervet Monkey, Rat, Dog, Pig, Horse, Mouse, Bovine |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human STAT2 protein. |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse Monoclonal KDM1/LSD1 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Mouse Monoclonal Ku70 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit polyclonal TERF2IP Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TERF2IP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 349-378 amino acids from the C-terminal region of human TERF2IP. |
Rabbit polyclonal Phospho-p53(S20) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RAB8A Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB8A antibody: synthetic peptide directed towards the middle region of human RAB8A. Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP |
Mouse Monoclonal STAT1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against Liver X Receptor
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human LXR protein sequence (between residues 50-150). |
ESRRB / ERR-Beta Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ESRRB / ERR Beta antibody was raised against synthetic 15 amino acid peptide from ligand-binding domain of human ESRRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Mouse, Rat, Elephant, Turkey, Chicken, Lizard (93%); Bat (87%); Stickleback, Medaka, Pufferfish, Zebrafish (80%). |
HNF4G / HNF4 Gamma Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | HNF4G / HNF4 Gamma antibody was raised against synthetic 16 amino acid peptide from internal region of human HNF4G. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Elephant, Panda, Dog (94%); Bat, Horse, Turkey, Chicken (88%); Rat, Pig, Opossum, Platypus (81%). |
NR2E3 / PNR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NR2E3 / PNR antibody was raised against synthetic 18 amino acid peptide from near N-terminus of human NR2E3. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset, Mouse, Hamster (94%); Bovine (89%); Elephant, Pig (83%). |
NR2E3 / PNR Rabbit Polyclonal (Ligand-binding Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chimpanzee, Gorilla, Hamster, Horse, Human, Mouse, Pig |
| Conjugation | Unconjugated |
| Immunogen | NR2E3 / PNR antibody was raised against synthetic 19 amino acid peptide from ligand-binding domain of human NR2E3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Mouse, Hamster, Elephant, Panda, Bovine, Bat, Horse, Pig (100%); Marmoset (95%). |
Rabbit polyclonal anti-Oct-4 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Horse |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Oct-4 protein. |
Rabbit polyclonal TAF7 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TAF7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 308-337 amino acids from the C-terminal region of human TAF7. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Monkey
Families
- Transcription Factors
Filter by
Target Symbol
- MAP2K3 (85)
- CTNNB1 (83)
- TP53 (83)
- NONO (30)
- ZSCAN21 (30)
- HDAC6 (25)
- SSB (25)
- GTF3C4 (15)
- PPP5C (15)
- RUVBL2 (15)
- SQSTM1 (15)
- STAT1 (11)
- APEX1 (10)
- GTF2F1 (10)
- HDAC1 (10)
- STAT5A (10)
- JUN (6)
- CBX8 (5)
- CD80 (5)
- EIF4E2 (5)
- ESR1 (5)
- HES1 (5)
- IRF3 (5)
- NEUROG1 (5)
- POGK (5)
- POLR2E (5)
- POLR2J2 (5)
- PSMC3 (5)
- RYBP (5)
- SEC14L2 (5)
- SKIL (5)
- WWTR1 (5)
- ATXN3 (4)
- CHAF1B (3)
- FOXP1 (3)
- IRF6 (3)
- MORF4 (3)
- MYC (3)
- CDX2 (2)
- ENO1 (2)
- HP1 GAMMA (2)
- NR2E3 (2)
- POU5F1 (2)
- RAB1B (2)
- TNF (2)
- AIP (1)
- C FOS (1)
- CALR (1)
- ESRRB (1)
- EZH2 (1)
- FOS (1)
- GTF2B (1)
- HDAC2 (1)
- HIF1A (1)
- HNF4G (1)
- HSF1 (1)
- HSF2 (1)
- ING1 (1)
- KCNH2 (1)
- KDM1A (1)
- LHX1 (1)
- MCM6 (1)
- NR1H3 (1)
- NR1I2 (1)
- NR4A1 (1)
- RAB25 (1)
- RAB8A (1)
- RAD51 (1)
- RAN (1)
- SOD2 (1)
- STAT2 (1)
- STAT3 (1)
- TAF7 (1)
- TBP (1)
- TERF2IP (1)
- TNFRSF1A (1)
- UBA52 (1)
- XRCC6 (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (212)
- MAPK signaling pathway (198)
- Colorectal cancer (177)
- Wnt signaling pathway (175)
- Amyotrophic lateral sclerosis (ALS) (171)
- Endometrial cancer (169)
- Thyroid cancer (169)
- Basal cell carcinoma (166)
- Prostate cancer (166)
- Toll-like receptor signaling pathway (116)
- Chronic myeloid leukemia (107)
- Huntington's disease (106)
- Cell cycle (98)
- Pancreatic cancer (96)
- GnRH signaling pathway (91)
- Focal adhesion (89)
- Neurotrophin signaling pathway (89)
- Fc epsilon RI signaling pathway (87)
- Apoptosis (86)
- Bladder cancer (86)
- Small cell lung cancer (86)
- Adherens junction (83)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (83)
- Glioma (83)
- Leukocyte transendothelial migration (83)
- Melanogenesis (83)
- Melanoma (83)
- Non-small cell lung cancer (83)
- Pathogenic Escherichia coli infection (83)
- Tight junction (83)
- p53 signaling pathway (83)
- Systemic lupus erythematosus (32)
- Jak-STAT signaling pathway (26)
- ErbB signaling pathway (19)
- Notch signaling pathway (16)
- Acute myeloid leukemia (14)
- Basal transcription factors (13)
- Chemokine signaling pathway (13)
- Metabolic pathways (12)
- Base excision repair (10)
- Purine metabolism (10)
- Pyrimidine metabolism (10)
- RNA polymerase (10)
- T cell receptor signaling pathway (10)
- B cell receptor signaling pathway (8)
- Allograft rejection (7)
- Graft-versus-host disease (7)
- RIG-I-like receptor signaling pathway (7)
- Renal cell carcinoma (7)
- Type I diabetes mellitus (7)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Maturity onset diabetes of the young (6)
- mTOR signaling pathway (6)
- Autoimmune thyroid disease (5)
- Cell adhesion molecules (CAMs) (5)
- Cytosolic DNA-sensing pathway (5)
- Insulin signaling pathway (5)
- Proteasome (5)
- TGF-beta signaling pathway (5)
- Viral myocarditis (5)
- Adipocytokine signaling pathway (4)
- Alzheimer's disease (3)
- Cytokine-cytokine receptor interaction (3)
- Asthma (2)
- Dilated cardiomyopathy (2)
- Glycolysis / Gluconeogenesis (2)
- Hematopoietic cell lineage (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- NOD-like receptor signaling pathway (2)
- Natural killer cell mediated cytotoxicity (2)
- RNA degradation (2)
- Type II diabetes mellitus (2)
- Antigen processing and presentation (1)
- DNA replication (1)
- Homologous recombination (1)
- Non-homologous end-joining (1)
- PPAR signaling pathway (1)
- Ribosome (1)