Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 440.00
2 Weeks
IL1 Receptor I (IL1R1) (Extracell. Dom.) mouse monoclonal antibody, clone 40101, Purified
| Applications | ELISA, IHC, R |
| Reactivities | Human |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
| Modifications | Phospho-specific |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Goat Polyclonal Antibody against BCL2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit Polyclonal DR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DR5 antibody was raised against a peptide corresponding to 20 amino acids near the carboxy terminus of human DR5 precursor. The immunogen is located within the last 50 amino acids of DR5. |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
Rabbit Polyclonal Anti-CD253 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD253 Antibody: A synthesized peptide derived from human CD253 |
AIF (AIFM1) (593-606) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Bat, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
| Immunogen | AIFM1 antibody was raised against synthetic peptide corresponding to amino acids 593 to 606 of human AIF |
Rabbit Polyclonal Trail Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TRAIL antibody was raised against a peptide corresponding to 17 amino acids near the carboxy terminus of human TRAIL. The immunogen is located within the last 50 amino acids of Trail. |
Rabbit polyclonal anti-AIFM1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIFM1. |
Rabbit polyclonal Trk A (Phospho-Tyr791) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 791 (P-V-YP-L-D) |
| Modifications | Phospho-specific |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
| Modifications | Phospho-specific |
TNFRSF10C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFRSF10C |
Rabbit anti-TNFRSF10B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFRSF10B |
Mouse Monoclonal anti-Bax Antibody
| Applications | IP |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PDCD8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDCD8 antibody: synthetic peptide directed towards the C terminal of human PDCD8. Synthetic peptide located within the following region: VDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPST |
Mouse Monoclonal DR5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Bax Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bax Antibody: A synthesized peptide derived from human Bax |
Rabbit Polyclonal Anti-TR10A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TR10A Antibody: A synthesized peptide derived from human TR10A |
Active filters
Families
- Transmembrane
Pathways
- Apoptosis