Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
Anti-HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS |
CD28 mouse monoclonal antibody, clone CD28.2, Azide Free
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
CD28 mouse monoclonal antibody, clone CD28.2, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Human, Primate |
HLA-DRA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRA |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
Mouse Anti-Human HLA-G Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM |
Rabbit Polyclonal Anti-FASL Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit polyclonal anti-HLA-DOB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB. |
Mouse Anti-Human CD40 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DRB3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HLA-DRB3 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-FAS ligand Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand |
HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified
| Applications | ELISA, FC, IP |
| Reactivities | Human |
CD28 mouse monoclonal antibody, clone B-T3, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Mouse Anti-Human HLA-DR Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CD28 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Mouse monoclonal HLA-G Antibody(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Active filters
Families
- Transmembrane
Pathways
- Autoimmune thyroid disease
Filter by
Category
Target Symbol
- CD40 (125)
- CD80 (103)
- CTLA4 (99)
- CD86 (62)
- CD28 (37)
- HLA-A (18)
- CD40LG (13)
- FASLG (13)
- HLA-DQA2 (13)
- TSHR (9)
- HLA-G (7)
- HLA-DRB5 (6)
- TPO (6)
- HLA-B (4)
- HLA-DRA (4)
- HLA-DMB (3)
- HLA-DRB3 (3)
- HLA-E (3)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)