Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-GNAS Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GNAS |
Rabbit Polyclonal Anti-TUBB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB4 antibody: synthetic peptide directed towards the N terminal of human TUBB4. Synthetic peptide located within the following region: TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI |
Rabbit Polyclonal Anti-ADCY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
USD 465.00
2 Weeks
SRC (N-term) (incl. pos. control) mouse monoclonal antibody, clone 11F1, Purified
| Applications | ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612) |
Rabbit polyclonal anti-TUBA4A(alpha Tubulin) antibody, Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 243 of alpha Tubulin 4a (Uniprot ID#P68366) |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit Polyclonal Anti-TUBB2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2B antibody is: synthetic peptide directed towards the N-terminal region of Human TUBB2B. Synthetic peptide located within the following region: GGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSV |
Rabbit Polyclonal Anti-TUBB6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB6 antibody: synthetic peptide directed towards the N terminal of human TUBB6. Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF |
Goat Polyclonal Anti-TUBA4A Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 80 aa to the N-terminus of human alpha tubulin produced in E. coli. |
Tubulin (TUBA1B) mouse monoclonal antibody, clone TU-16, Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human, Porcine |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Tubulin (TUBA1B) mouse monoclonal antibody, clone TU-16, Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | All Species |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Drosophila, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit Polyclonal antibody to alpha Tubulin (tubulin, alpha 1b)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 118 and 365 of alpha Tubulin (Uniprot ID#P68363) |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529 |
| Modifications | Phospho-specific |
Rabbit anti-DRD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DRD1 |
Rabbit anti-HTR2B Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HTR2B |
Rabbit anti-GRB2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRB2 |
Active filters
Pathways
- Gap junction
Filter by
Target Symbol
- MAP2K1 (237)
- EGFR (207)
- MAPK1 (74)
- PDGFRA (63)
- KRAS (58)
- MAPK7 (57)
- PDGFRB (50)
- TUBAL3 (50)
- GNAS (48)
- HRAS (47)
- EGF (38)
- MAP2K2 (34)
- RAF1 (33)
- TUBB2B (32)
- TUBB4A (32)
- TUBA8 (31)
- SRC (30)
- PRKCA (27)
- CDK1 (23)
- MAPK3 (23)
- GJA1 (20)
- TUBA1A (20)
- TUBA1B (20)
- NRAS (17)
- PDGFB (16)
- PRKG1 (15)
- TUBA3E (15)
- TUBB1 (15)
- TUBB2A (15)
- PRKG2 (14)
- PRKCB (12)
- TUBB (12)
- TUBB3 (12)
- GRB2 (11)
- PDGFA (11)
- TUBA4A (11)
- GNAI1 (10)
- LPAR1 (9)
- GRM1 (8)
- HTR2C (8)
- PRKACA (8)
- TUBA1C (8)
- DRD1 (7)
- GRM5 (7)
- HTR2B (7)
- TJP1 (7)
- CDC2 (6)
- PDGFD (6)
- PRKCG (6)
- ADRB1 (5)
- DRD2 (5)
- PDGFC (5)
- TUBA3C (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- GNA11 (4)
- GNAI2 (4)
- GUCY1B1 (4)
- PLCB3 (4)
- PRKACB (4)
- ADCY2 (3)
- ADCY6 (3)
- CSNK1D (3)
- GJD2 (3)
- GNAI3 (3)
- HTR2A (3)
- MAP2K5 (3)
- PLCB1 (3)
- PRKACG (3)
- PRKX (3)
- SOS2 (3)
- ADCY3 (2)
- ADCY8 (2)
- GNAQ (2)
- GUCY1A1 (2)
- ITPR2 (2)
- MAP3K2 (2)
- PLCB2 (2)
- SOS1 (2)
- TUBA3D (2)
- TUBB6 (2)
- ADCY7 (1)
- ADCY9 (1)
- GUCY1A2 (1)
- GUCY1A3 (1)
- GUCY1B3 (1)
- ITPR1 (1)
- ITPR3 (1)
- TUBB4Q (1)
- TUBB8 (1)
Reactivities
- Human (1412)
- Mouse (1194)
- Rat (1153)
- Dog (298)
- Monkey (289)
- Bovine (29)
- Chicken (23)
- Xenopus (14)
- Canine (12)
- Pig (12)
- Rabbit (7)
- Hamster (6)
- Bat (5)
- Chimpanzee (5)
- Cow (5)
- Drosophila (5)
- Horse (5)
- Rhesus Monkey (5)
- Porcine (4)
- Gorilla (3)
- Zebrafish (3)
- All Species (2)
- Canis (2)
- Dictyostelium (2)
- Mammalian (2)
- Primate (2)
- X. tropicalis (2)
- Chlamydomonas (1)
- Feline (1)
- Fish (1)
- Frog (1)
- Goat (1)
- Guinea Pig (1)
- Murine (1)
- Sheep (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1622)
- Protein Kinase (937)
- Transmembrane (468)
- ES Cell Differentiation/IPS (455)
- Secreted Protein (261)
- Adult stem cells (250)
- Stem cell relevant signaling - JAK/STAT signaling pathway (237)
- Cancer stem cells (207)
- GPCR (52)
- Embryonic stem cells (43)
- Induced pluripotent stem cells (43)
- Stem cell - Pluripotency (34)
- Ion Channels: Other (23)