Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 240.00
2 Weeks
PDGF Receptor beta (PDGFRB) mouse monoclonal antibody, clone 18A2, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Active filters
Pathways
- Glioma
Filter by
Target Symbol
- TP53 (255)
- MAP2K1 (237)
- EGFR (207)
- CDKN2A (198)
- AKT1 (127)
- MDM2 (121)
- BRAF (100)
- MAPK1 (74)
- MTOR (72)
- PIK3CG (64)
- PDGFRA (63)
- RB1 (59)
- KRAS (58)
- PDGFRB (50)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- EGF (38)
- CCND1 (37)
- CDKN1A (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- SHC1 (32)
- IGF1 (31)
- CAMK2B (29)
- IGF1R (29)
- PRKCA (27)
- PIK3CA (25)
- ARAF (24)
- MAPK3 (23)
- PTEN (23)
- AKT3 (19)
- NRAS (17)
- PDGFB (16)
- PLCG1 (15)
- PIK3R1 (14)
- E2F1 (12)
- PRKCB (12)
- CAMK2A (11)
- GRB2 (11)
- PDGFA (11)
- CDK6 (10)
- CDK4 (9)
- E2F2 (9)
- PLCG2 (9)
- PRKCG (6)
- TGFA (6)
- CAMK2G (5)
- CALM2 (4)
- PIK3CB (4)
- PIK3R3 (4)
- CALM3 (3)
- CAMK2D (3)
- E2F3 (3)
- SHC3 (3)
- SOS2 (3)
- B RAF (2)
- PIK3R2 (2)
- SHC4 (2)
- SOS1 (2)
- CALM1 (1)
- CALML3 (1)
- CALML5 (1)
- CALML6 (1)
- SHC2 (1)
Reactivities
- Human (2259)
- Mouse (1594)
- Rat (1515)
- Monkey (411)
- Dog (334)
- Bovine (14)
- Chicken (13)
- Pig (10)
- Cow (7)
- Xenopus (7)
- Rabbit (6)
- Canine (5)
- Hamster (4)
- Drosophila (3)
- Canis (2)
- Chimpanzee (2)
- Primate (2)
- Rhesus Monkey (2)
- Feline (1)
- Fish (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Sheep (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2499)
- Protein Kinase (1250)
- ES Cell Differentiation/IPS (693)
- Transcription Factors (459)
- Transmembrane (393)
- Stem cell - Pluripotency (292)
- Adult stem cells (245)
- Secreted Protein (244)
- Stem cell relevant signaling - JAK/STAT signaling pathway (244)
- Cancer stem cells (207)
- Embryonic stem cells (38)
- Induced pluripotent stem cells (38)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Stem cell relevant signaling - Wnt Signaling pathway (37)
- Phosphatase (23)