Germany
Japan
United Kingdom
China
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10264, Purified
| Applications | ELISA |
| Reactivities | Human |
Antibodies
Download
FSH beta (FSHB) (intact) mouse monoclonal antibody, clone 090-10243, Purified
| Applications | ELISA |
| Reactivities | Human |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Mouse Monoclonal anti-CACNA1C Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Mouse Monoclonal anti-CACNA1D Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-CACNA1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal antibody to CaMKII delta (calcium/calmodulin-dependent protein kinase II delta)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 249 and 445 of CaMK2D (Uniprot ID#Q13557) |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GNAS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQ |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
USD 395.00
2 Weeks
Luteinizing Hormone beta (LHB) mouse monoclonal antibody, clone 090-11412, Purified
| Applications | ELISA |
| Reactivities | Human |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
USD 395.00
2 Weeks
Luteinizing Hormone beta (LHB) mouse monoclonal antibody, clone 057-10037, Purified
| Applications | ELISA |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- GnRH signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- EGFR (207)
- JUN (183)
- MAP2K3 (158)
- MAPK13 (99)
- FSHB (74)
- MAPK1 (74)
- KRAS (58)
- MAPK7 (57)
- MAPK8 (55)
- GNAS (48)
- HRAS (47)
- MAPK14 (41)
- MAP2K4 (38)
- MAP2K2 (34)
- RAF1 (33)
- MAPK9 (31)
- SRC (30)
- ATF4 (29)
- CAMK2B (29)
- PRKCA (27)
- HBEGF (26)
- MAPK3 (23)
- MMP2 (23)
- MAPK10 (19)
- PLA2G3 (19)
- PRKCD (19)
- NRAS (17)
- ELK1 (15)
- LHB (15)
- PLA2G6 (13)
- PRKCB (12)
- CAMK2A (11)
- GRB2 (11)
- CGA (10)
- MAP2K6 (10)
- MAPK12 (9)
- PTK2B (9)
- PRKACA (8)
- MAPK11 (7)
- MMP14 (7)
- PLA2G2A (7)
- CACNA1C (6)
- GNRHR (6)
- CAMK2G (5)
- CDC42 (5)
- MAP2K7 (5)
- PLA2G4A (5)
- ADCY1 (4)
- ADCY4 (4)
- ADCY5 (4)
- CALM2 (4)
- GNA11 (4)
- GNRH1 (4)
- MAP3K1 (4)
- MAP3K4 (4)
- PLCB3 (4)
- PLD2 (4)
- PRKACB (4)
- ADCY2 (3)
- ADCY6 (3)
- CALM3 (3)
- CAMK2D (3)
- PLA2G5 (3)
- PLCB1 (3)
- PRKACG (3)
- PRKX (3)
- SOS2 (3)
- ADCY3 (2)
- ADCY8 (2)
- CACNA1D (2)
- GNAQ (2)
- GNRH2 (2)
- ITPR2 (2)
- JMJD7-PLA2G4B (2)
- MAP3K2 (2)
- MAP3K3 (2)
- PLA2G12A (2)
- PLA2G4E (2)
- PLCB2 (2)
- PLD1 (2)
- SOS1 (2)
- ADCY7 (1)
- ADCY9 (1)
- CACNA1S (1)
- CALM1 (1)
- CALML3 (1)
- CALML5 (1)
- CALML6 (1)
- ITPR1 (1)
- ITPR3 (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2C (1)
- PLA2G2D (1)
- PLA2G2E (1)
Reactivities
- Human (1805)
- Mouse (1590)
- Rat (1500)
- Dog (454)
- Monkey (361)
- Bovine (20)
- Pig (13)
- Chicken (12)
- Xenopus (7)
- Rabbit (5)
- Canine (4)
- Cow (4)
- Drosophila (3)
- Hamster (3)
- Rhesus Monkey (3)
- Canis (2)
- Horse (2)
- Porcine (2)
- C. elegans (1)
- Feline (1)
- Fish (1)
- Gibbon (1)
- Gorilla (1)
- Guinea Pig (1)
- Mammalian (1)
- Primate (1)
- Sheep (1)
- Tobacco hornworm (1)
- X. tropicalis (1)
- Zebrafish (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1960)
- Protein Kinase (1312)
- ES Cell Differentiation/IPS (566)
- Secreted Protein (414)
- Transcription Factors (385)
- Transmembrane (292)
- Stem cell relevant signaling - JAK/STAT signaling pathway (237)
- Adult stem cells (207)
- Cancer stem cells (207)
- Protease (30)
- Ion Channels: Calcium (9)
- GPCR (6)