Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
CD11b (ITGAM) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to a sequence shared between the Mouse (NP_001076429.1) and Human gene products (NP_001139280.1). After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126) |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Active filters
Pathways
- Leukocyte transendothelial migration
Filter by
Target Symbol
- CTNNB1 (162)
- PECAM1 (148)
- CD99 (121)
- MAPK13 (99)
- PIK3CG (64)
- VCAM1 (53)
- PXN (49)
- PIK3R5 (47)
- NCF4 (45)
- CTNND1 (44)
- VASP (43)
- MAPK14 (41)
- PTK2 (41)
- ACTB (38)
- PIK3CD (35)
- PTPN11 (35)
- SHC1 (32)
- BCAR1 (30)
- ICAM1 (30)
- EZR (29)
- ITGB1 (27)
- PRKCA (27)
- MYL7 (26)
- CLDN6 (25)
- PIK3CA (25)
- CXCR4 (23)
- MMP2 (23)
- ITGAM (21)
- CDH5 (20)
- MMP9 (19)
- CLDN3 (17)
- RASSF5 (17)
- CXCL12 (16)
- ACTN1 (15)
- F11R (15)
- PLCG1 (15)
- ROCK2 (15)
- PIK3R1 (14)
- VCL (14)
- CLDN5 (13)
- CLDN7 (13)
- RHOH (13)
- NCF1 (12)
- PRKCB (12)
- CLDN1 (11)
- CTNNA1 (11)
- ITGA4 (11)
- GNAI1 (10)
- ITGAL (10)
- VAV1 (10)
- MAPK12 (9)
- MYL9 (9)
- PLCG2 (9)
- PTK2B (9)
- RHOA (9)
- ACTN2 (8)
- CLDN11 (8)
- CLDN4 (8)
- MSN (8)
- ACTG1 (7)
- CYBB (7)
- ITGB2 (7)
- MAPK11 (7)
- ROCK1 (7)
- THY1 (7)
- ACTN3 (6)
- ACTN4 (6)
- ARHGAP5 (6)
- CLDN10 (6)
- CLDN2 (6)
- MYL2 (6)
- PRKCG (6)
- RAC1 (6)
- RAP1A (6)
- CDC42 (5)
- CLDN8 (5)
- NOX1 (5)
- RAPGEF3 (5)
- SIPA1 (5)
- CLDN14 (4)
- CLDN19 (4)
- GNAI2 (4)
- ITK (4)
- JAM2 (4)
- NOX3 (4)
- PIK3CB (4)
- PIK3R3 (4)
- RAP1B (4)
- VAV3 (4)
- CLDN15 (3)
- CLDN16 (3)
- CLDN18 (3)
- CLDN23 (3)
- CYBA (3)
- ESAM (3)
- GNAI3 (3)
- NCF2 (3)
- VAV2 (3)
- ARHGAP35 (2)
- JAM3 (2)
Reactivities
- Human (1737)
- Mouse (1230)
- Rat (1155)
- Dog (182)
- Monkey (179)
- Bovine (20)
- Chicken (20)
- Pig (15)
- Cow (13)
- Rabbit (12)
- Canine (6)
- Canis (6)
- Rhesus Monkey (6)
- Drosophila (5)
- Xenopus (5)
- Hamster (4)
- Primate (4)
- Zebrafish (4)
- Sheep (3)
- Chimpanzee (2)
- Guinea Pig (2)
- Horse (2)
- Porcine (2)
- X. tropicalis (2)
- All Species (1)
- Avian (1)
- Baboon (1)
- Bat (1)
- Broad (1)
- C. elegans (1)
- Fish (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Orang-Utan (1)