Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ACTB |
TA349205 is a possible alternative to TA349208.
Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanMyosin Light Chain 2 around the phosphorylation site of serine 18 (A-T-SP-N-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Goat Polyclonal Anti-Vimentin Antibody
| Applications | FC, IF, WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vimentin Antibody: Peptide with sequence C-QVINETSQHHDDLE, from the C Terminus of the protein sequence according to NP_003371.2. |
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Anti-Claudin 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Claudin 2 Antibody: A synthesized peptide derived from human Claudin 2 |
Goat Polyclonal Anti-CD31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Goat Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Active filters
Reactivities
- Mouse
Pathways
- Leukocyte transendothelial migration
Filter by
Target Symbol
- CTNNB1 (144)
- MAPK13 (96)
- PIK3CG (61)
- PIK3R5 (46)
- CTNND1 (43)
- NCF4 (41)
- PXN (37)
- VASP (36)
- PIK3CD (33)
- MAPK14 (32)
- PTPN11 (29)
- SHC1 (29)
- BCAR1 (28)
- ACTB (27)
- PTK2 (27)
- MYL7 (26)
- CLDN6 (23)
- EZR (23)
- PIK3CA (23)
- PRKCA (22)
- MMP2 (19)
- RASSF5 (17)
- CLDN3 (15)
- ITGB1 (15)
- CLDN5 (12)
- RHOH (12)
- ROCK2 (12)
- VCL (11)
- ACTN1 (10)
- PECAM1 (10)
- CTNNA1 (9)
- PIK3R1 (9)
- PLCG1 (9)
- PLCG2 (9)
- CLDN1 (8)
- CLDN7 (8)
- PRKCB (8)
- CXCR4 (7)
- MAPK12 (7)
- MYL9 (7)
- PTK2B (7)
- RHOA (7)
- VAV1 (7)
- ARHGAP5 (6)
- CDH5 (6)
- CLDN4 (6)
- CXCL12 (6)
- GNAI1 (6)
- ACTG1 (5)
- CLDN10 (5)
- CLDN11 (5)
- ITGAM (5)
- MAPK11 (5)
- MSN (5)
- RAC1 (5)
- ROCK1 (5)
- CDC42 (4)
- ITGA4 (4)
- MMP9 (4)
- NOX1 (4)
- PRKCG (4)
- RAP1A (4)
- ACTN2 (3)
- ACTN3 (3)
- ACTN4 (3)
- CLDN14 (3)
- CYBB (3)
- ITGB2 (3)
- NOX3 (3)
- RAPGEF3 (3)
- THY1 (3)
- ARHGAP35 (2)
- CLDN16 (2)
- CLDN19 (2)
- F11R (2)
- GNAI3 (2)
- ICAM1 (2)
- ITGAL (2)
- ITK (2)
- MYL2 (2)
- NCF1 (2)
- NCF2 (2)
- PIK3CB (2)
- PIK3R2 (2)
- RAC2 (2)
- RAP1B (2)
- SIPA1 (2)
- VAV2 (2)
- VAV3 (2)
- CLDN2 (1)
- CTNNA3 (1)
- CYBA (1)
- GNAI2 (1)
- JAM2 (1)
- JAM3 (1)
- MLLT4 (1)
- MYL12B (1)
- PIK3R3 (1)
- RAPGEF4 (1)
- TXK (1)