Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, DyLight488 conjugated
| Applications | FC |
| Reactivities | Human |
| Conjugation | DyLight 488 |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Anti-BIRC5/Survivin mouse mAb, clone OTI2D9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3C2-4
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 3G11-14
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 4A5-19
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5F4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 5G12-21
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6F5-23
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 6H8-22
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8E8-2
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 8F6-6
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 9G5-20
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 12G4-15
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 15C4-8
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HER2 (ERBB2) Mouse Monoclonal Antibody, clone 16F12-11
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Pathways
- Pathways in cancer
Filter by
Target Symbol
- TP53 (238)
- ERBB2 (227)
- MAP2K1 (225)
- CDKN2A (197)
- JUN (182)
- EGFR (163)
- GLI1 (151)
- CTNNB1 (146)
- IL6 (132)
- MDM2 (118)
- AKT1 (114)
- NKX3-1 (114)
- BRAF (99)
- BCL2 (89)
- MLH1 (85)
- KIT (80)
- FGF21 (75)
- STAT5A (74)
- MAPK1 (69)
- MTOR (66)
- CDH1 (65)
- FGFR2 (64)
- PIK3CG (64)
- CDK2 (63)
- FOS (61)
- RET (60)
- BID (58)
- KLK3 (56)
- KRAS (56)
- PDGFRA (56)
- RB1 (56)
- FOXO1 (55)
- MET (54)
- VEGFA (49)
- RARA (48)
- PIK3R5 (46)
- RALBP1 (46)
- RASSF1 (46)
- WNT3 (46)
- HRAS (45)
- AR (44)
- CASP3 (44)
- PTGS2 (44)
- RELA (44)
- BIRC3 (43)
- BIRC5 (42)
- STAT1 (42)
- AKT2 (41)
- HDAC1 (41)
- MYC (41)
- DVL2 (39)
- PDGFRB (39)
- IKBKG (38)
- LAMB3 (38)
- MAPK8 (38)
- ARNT (36)
- CDKN1A (36)
- CDKN2B (35)
- FGFR1 (35)
- PIK3CD (35)
- PTCH1 (34)
- MAP2K2 (33)
- NFKB1 (33)
- BAX (31)
- HGF (31)
- CCND1 (30)
- FN1 (30)
- DAPK2 (28)
- MAPK9 (28)
- NFKBIA (28)
- PTK2 (28)
- STAT3 (28)
- BCL2L1 (27)
- HIF1A (27)
- NOS2 (27)
- SMAD2 (27)
- CSF2RA (26)
- EGF (26)
- HSP90AB1 (26)
- IGF1R (26)
- NCOA4 (26)
- FGF2 (25)
- ARAF (24)
- HDAC2 (24)
- KITLG (24)
- PIK3CA (24)
- CXCL8 (23)
- GLI2 (22)
- IGF1 (22)
- ITGB1 (22)
- PRKCA (22)
- VEGFB (22)
- VEGFD (22)
- FH (21)
- MMP2 (21)
- RAF1 (21)
- APC (20)
- BMP4 (20)
- CHUK (20)
- EPAS1 (20)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (6817)
- Transcription Factors (2122)
- ES Cell Differentiation/IPS (2061)
- Protein Kinase (1974)
- Transmembrane (1569)
- Secreted Protein (1115)
- Stem cell - Pluripotency (721)
- Adult stem cells (671)
- Embryonic stem cells (486)
- Cancer stem cells (444)
- Stem cell relevant signaling - JAK/STAT signaling pathway (390)
- Stem cell relevant signaling - DSL/Notch pathway (312)
- Protease (211)
- Nuclear Hormone Receptor (147)
- Stem cell relevant signaling - Wnt Signaling pathway (135)
- Induced pluripotent stem cells (113)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (112)
- GPCR (37)
- Phosphatase (15)